KEGG   Mycobacterium intracellulare ATCC 13950: OCU_42970Help
Entry
OCU_42970         CDS       T02158                                 

Definition
(GenBank) hypothetical protein
Organism
mia  Mycobacterium intracellulare ATCC 13950
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: zf-HC2 RskA
Motif
Other DBs
NCBI-ProteinID: AFC45516
UniProt: H8IQW0
Position
complement(4529855..4530583)
Genome map
AA seq 242 aa AA seqDB search
MKDMDEMNTPVADIGPPEDRYAMWDAAYVLGSLSAAQRREFETHMARCPACREAVADLSG
VPALLSQLDRDEVAAIDESGPAPEMSEEMLPSLLAAVRWRRRRTRVVTWVASAAAAAVLA
IGVFVGLQAWSSTPAQQVTASAEPMAQVGTSLLTSSVQVTGQHWGTSIALRCVCLAPLNA
HHDTLAMVVVGRDGSQTRLATWVAVPGHTATPVGAISTPVDQIAAVQVVAADSGKVLLQR
SL
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggacatggatgaaatgaacacgccggtggccgatatcggccctcccgaagaccgc
tacgcgatgtgggatgccgcatacgtgctggggtcgctgtcggccgcgcaacgccgcgaa
ttcgagacgcacatggcgcgctgcccggcctgccgtgaggcggtcgcagacctcagcggc
gtgccggcactgctttcgcaactggaccgcgacgaggtggccgcgatcgacgagtccggc
ccggcgccggagatgtccgaggagatgctgccgtcgttgctggcggcggtgcggtggcgc
cggcggcgcacccgggtggtgacctgggtggcctccgccgcggcggccgcggtgctggcg
atcggggtgttcgtcggcctgcaggcctggtcgtcgactcccgcccagcaggtgaccgcg
tcggccgagccgatggcgcaggtgggcacctcgctgctgacctccagcgtccaggtcacc
ggccagcactggggcacatccatcgcgcttcggtgcgtgtgcctggccccgctgaacgcg
caccatgacacgctggcgatggtcgtggtgggtcgcgacggcagccaaacgcggctggcg
acctgggtggccgtgcccggtcacaccgcgacacccgtgggcgcgatctcgaccccggtc
gaccagatcgccgccgtgcaagtggtcgccgccgacagcggcaaggtgttgttgcagcgt
tcgctgtag

DBGET integrated database retrieval system