KEGG   Mycobacterium intracellulare ATCC 13950: OCU_42980Help
Entry
OCU_42980         CDS       T02158                                 

Definition
(GenBank) RNA polymerase sigma factor SigL
  KO
K03088  
RNA polymerase sigma-70 factor, ECF subfamily
Organism
mia  Mycobacterium intracellulare ATCC 13950
Brite
Transcription machinery [BR:mia03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     OCU_42980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4530604..4531095)
Genome map
AA seq 163 aa AA seqDB search
MKALFDEHAAVLWRYALRLTGDTSQSEDVVQETLLRAWQHPEVVGDTERSARAWLFTVAR
NMIIDDRRSARYRNVVGSTDVSGAPEQSTPDEVNAALDRLLIADAMAQLSADHRAVIERS
YYRGWTTTQIAADLGIAEGTVKSRLHYAVRALRLTLQELGVTR
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgcttttcgacgaacacgccgcggttctgtggcgctacgcgttgcgcctgacg
ggggacacgagccagtccgaggatgtggtccaggaaacgctgctgcgggcgtggcagcat
cccgaagtcgtcggggacaccgagcgctcggcgcgggcgtggttgttcaccgtcgcccgc
aacatgatcatcgacgatcggcgcagcgcgcggtaccgcaacgtcgtcggttcgaccgac
gtctcgggggcgcccgaacagtccacgccggacgaggtcaacgcggccctggaccggttg
ctgatagcggacgcgatggcccagctgtccgccgatcaccgagcggtgatcgaacggtcc
tactaccgcggttggaccaccacgcagatagctgcagacctcggcatcgccgagggaacg
gtgaagtcgcgactacactatgccgtacgggcgttgcgactcactctgcaggaacttggg
gttacccgatga

DBGET integrated database retrieval system