KEGG   Mycobacterium intracellulare ATCC 13950: OCU_42990Help
Entry
OCU_42990         CDS       T02158                                 

Definition
(GenBank) methionine aminopeptidase
  KO
K01265  methionyl aminopeptidase [EC:3.4.11.18]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Brite
Enzymes [BR:mia01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.18  methionyl aminopeptidase
     OCU_42990
Peptidases [BR:mia01002]
 Metallo Peptidases
  Family M24
   OCU_42990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M24
Motif
Other DBs
NCBI-ProteinID: AFC45518
UniProt: H8IQW2
Position
complement(4531304..4532107)
Genome map
AA seq 267 aa AA seqDB search
MNPLARLRSRKVVPQRSAGELDAMAAAGAVVAAALQAVRAAAVSGVSTLSLDEIAESVIR
DAGAVPSFLGYHGYPASICASVNERVVHGIPSAAEVLGSGDLVSIDCGAVLDGWHGDAAI
TFGIGTLDAADEALSQATRESLEAGIAAMVPGNRLTDVSHAIEMGTHAAAARHSRSFGIV
EGYGGHGIGRQMHMDPFLPNEGSPGRGPQLAPGSVLAIEPMLTLGTGKTVVLDDQWTVVT
TDGSRAAHWEHTVAVTESGPRILTLGA
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgctggcgcggctgcggagtcgcaaggtggtgccgcagcgcagcgccggcgaa
ctcgacgcgatggccgcggcgggcgcggtcgtggcggccgcgctgcaggccgtccgggcc
gccgcggtgtccggcgtatcgacgctgagcctcgacgagatcgccgaatcggtgatccgc
gacgccggggcggtgccgtcgttcctgggctatcacggctacccggcatcgatctgcgcg
tcggtcaacgagcgggtggtccacggaatcccttcggccgcagaggttttgggctcgggt
gacctggtatcgatcgactgcggcgccgtgctggacggctggcacggcgacgccgcaatc
accttcgggatcgggaccctggatgcggccgacgaagcgctgtcccaggccaccagggaa
tcgctggaggccgggatcgccgcgatggtgcccggcaaccggttgaccgacgtatcgcac
gccatcgagatgggtacgcacgcggccgcggcccgccactcgcggtccttcggaatcgtc
gagggatacggcggccacggcatcggccggcagatgcacatggacccgttcctgcccaac
gagggctcgccagggcgcgggccgcagctggcccccgggtcggtgctggccatcgagccg
atgctgacgctgggaaccggcaagaccgtggtgctcgacgaccagtggacggtcgtcacc
accgacggctcgcgggcggcacactgggagcacaccgtcgcggtcaccgagtccggaccg
cgcatcctgaccctgggggcctga

DBGET integrated database retrieval system