KEGG   Mycobacterium intracellulare ATCC 13950: OCU_43110Help
Entry
OCU_43110         CDS       T02158                                 

Definition
(GenBank) hypothetical protein
Organism
mia  Mycobacterium intracellulare ATCC 13950
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LCM
Motif
Other DBs
NCBI-ProteinID: AFC45530
UniProt: H8IRK2
Position
4542870..4543730
Genome map
AA seq 286 aa AA seqDB search
MGATATMVAASRAVASKGPDALLDDPLADPLVRAVGLDPFIRIIDGEIDFEDDPLFNRRA
RAEQITVRTRFFDDFFLDATNAGIKQAVILASGLDTRAYRLRWPAGTVVYEIDQPDVIAF
KTDTLAGLGAAPTAQRRTISIDLRDDWPAALRDGGFDVTQPTAWSAEGLLPYLPPEAQDR
LFDNITALSAPGSRVATEHVPDPDAFSDERLRRISERWQRFGFDLNAADLFYRGERNVVV
DYLNGHGWQVSAHPARELYARNGFEFPEDEMAATFGELSYVAATLE
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
gtgggggcgacggcgaccatggtcgccgcgtcccgcgcggtcgcgtcgaagggtcccgac
gcgctgctcgacgatccgctggccgacccgctggtccgcgccgtcggcctggatcccttc
atccggatcatcgacggcgagatcgacttcgaggacgacccgctgttcaaccgccgggcg
cgggccgagcagatcacggtgcgcaccaggtttttcgacgacttcttcctggacgcgacg
aacgcgggcatcaagcaggcggtcatcctggcctccggcctggacacccgggcctaccgc
ctgcggtggccggcgggaaccgtggtctacgagatcgaccagcccgacgtcatcgccttc
aagaccgacacgctggccggcctcggcgccgcccccaccgcgcagcgccgcacgatcagc
atcgacctgcgcgacgactggccggcggccttgcgcgacggtggttttgacgtcacccag
ccgaccgcctggagcgccgaggggctgctgccctacctgccgcccgaggcgcaggaccgg
ctgttcgacaacatcaccgcgctgtccgcgccgggcagccgggtggcgaccgaacacgtg
cccgaccccgacgcgttctccgacgagcgcctgcgccgcatctccgagcggtggcagcgc
ttcggcttcgacctgaatgcggccgacctgttctaccggggcgagcgcaacgtcgtcgtc
gactacctgaacggccatggctggcaggtgagcgcgcatcccgcccgggaactatacgcc
cgcaacgggtttgagtttcccgaggacgagatggcggccaccttcggtgagctgagctac
gtcgccgcgacgctcgagtaa

DBGET integrated database retrieval system