KEGG   Mycobacterium intracellulare ATCC 13950: OCU_43120Help
Entry
OCU_43120         CDS       T02158                                 

Definition
(GenBank) methyltransferase, putative, family protein
Organism
mia  Mycobacterium intracellulare ATCC 13950
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4543741..4544655
Genome map
AA seq 304 aa AA seqDB search
MPRTHDDNWDLASSVGATATMVAAGRAMATKDPRGLINDPFAEPLVRAVGVEFFTKMMDG
ELDIDAIENASSVRVQAMIDGMTVRTRYFDDYFMDAVGAGVRQVVILASGLDARAYRLPW
PDGTVVYEIDQPQVIEFKTSTLAGIGAEPTADRRTVGIDLRADWPTALKDAGFDTTAPTA
WLAEGLLIYLPPDAQDRLFDNITALSAPGSTIATEFVPGIVDFDAEKVREMSGSFRDHGV
DIDMASLVYTGDRNHVVDYLSSTGWHAEGVTRTELFERGGFDVRAPEDDDPLGEIVFISG
RLGG
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgccacgcactcacgacgacaactgggatctggcgtccagcgtcggcgccaccgcgacg
atggtcgcggcggggcgggcgatggcgacgaaggatccgcggggtctgatcaacgatccg
ttcgccgagccgctggtgcgggcggtcggggtggaattcttcaccaagatgatggacggc
gagctcgacatcgatgcgatcgagaacgcctcgtcggtgcgcgttcaggcgatgatcgac
ggaatgacggtgcgcaccaggtacttcgacgactatttcatggacgccgtcggcgccggc
gtgcgtcaggtggtgatcctggcctccgggctggacgcgcgcgcctaccggttgccgtgg
ccggacggcacggtcgtctacgagatcgaccagccccaggtgatcgagttcaaaaccagc
acgctggccggcatcggcgccgagccgaccgccgatcggcgcaccgtcggcatcgacctg
cgggcggactggccgaccgcgctgaaggacgccgggttcgatacgaccgcaccgacggcg
tggctggccgagggcctgctgatctacctgccgccggacgcccaggaccggctgttcgac
aacatcaccgcgctcagcgcgcccggcagcaccatcgccaccgaattcgtgcccggcatc
gtggatttcgacgccgagaaggtgcgggagatgtccggttcgttccgggaccacggcgtg
gacatcgacatggcgtcgctggtctacaccggcgaccgcaaccatgtcgtggactacctg
tcgagcaccgggtggcacgccgagggcgtgacccgcaccgagcttttcgagcgcggcggg
ttcgacgtgcgcgccccggaggacgacgacccgctcggtgagatcgtcttcatcagcggc
aggctcggcggctag

DBGET integrated database retrieval system