KEGG   Mycobacterium intracellulare ATCC 13950: OCU_43130Help
Entry
OCU_43130         CDS       T02158                                 

Definition
(GenBank) hypothetical protein
  KO
K04773  
protease IV [EC:3.4.21.-]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Brite
Enzymes [BR:mia01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     OCU_43130
Peptidases [BR:mia01002]
 Serine Peptidases
  Family S49: protease IV family
   OCU_43130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4544663..4546450)
Genome map
AA seq 595 aa AA seqDB search
MFAFLPSIPGLSKGADEVRALADRVDTARHHGVPNGCVLELDLRSMPPETSGFDPLAMIT
GGSRPVSLRDTVSAIYRAAEDPRVAGLIARVQLTASPSAAVQELREAIVAFTAAKPSLAW
AETYPGTLSYYLASAFGEVWMQPAGSVGLIGFASNATFLRDAFDKAGIEAEVVARGEYKS
AANRFTEHGFTEAHREAVTRMLESIREQVWEAVGTSRKLDAAALDALADRAPLLREEAVS
SGLVDRIGFRDEAYDRIAELVGVKDVSEENAPPRLYLSRYAGAARSRLIPPAPSVPGRRP
KPTVAVINVDGTIVDGRGGPQFLPFGTSTVGSDTIAPALREAAADDSVSAIVVRVNSPGG
SVTASETLWREVKKARNRGKPVVASMGSVAASGGYYIAVAADAVVASPATITGSIGVLTG
KLVIRDLLGRLGVGSDTVRTNANADAWAIDTPFTPEQRAHREAEADLLYADFVARVADGR
NLTKDAVDRVARGRVWTGADALERGLVDELGGFRTALRRAKILAGLDEDADVRIVTYPGG
SLLDMLRPRASSQPAAASLPDALGALLGRTIGGIVDNVERSVSGASALWAGPWRL
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgttcgctttcctgccctcgatacccggtttgtcaaaaggcgcggacgaggtgcgcgcg
ctggccgaccgggtcgacaccgcacgtcatcacggcgtgcccaacggctgcgtgctcgaa
ttggatctgcgctcaatgccgccggagacgtcggggttcgacccgctggcgatgatcacc
ggtgggagccgtccggtgtcgctgcgcgacacggtgtccgccatctaccgggcggccgag
gatccgcgggtcgccgggctgatcgcccgcgtgcaactgacggcgtcgccgtcggccgcg
gtgcaggaactgcgcgaggccatcgtcgcgttcaccgccgccaagccgtcactggcctgg
gccgagacctacccgggcacgttgtcgtactacctggcctcggccttcggcgaggtctgg
atgcagccggcgggaagcgtcgggctgatcggcttcgccagcaacgccacctttttacgc
gacgcgttcgacaaggccggcatcgaagccgaagtcgtcgcgcgcggcgaatacaagtcc
gcggcaaaccgtttcaccgagcacggcttcaccgaggcccaccgcgaggccgtcacccgg
atgctcgagagcatccgggagcaggtgtgggaagcggtggggacatcacgcaagctcgac
gccgccgccctggacgccctggccgatcgcgccccgctgttgcgcgaggaggccgtgtcc
tcgggcctggtcgaccgtatcggattccgggacgaagcctatgaccgcatcgcggaactg
gttggcgtgaaagatgtttcggaggagaatgcgccgccgcggctgtatctgtcgcgctac
gccggcgccgcacggtcgcggctgatcccgccggcgccgtcggtgcccggtcgccggccc
aagccgacggtggccgtcatcaacgtcgacggcacgatcgtcgacgggcgcggtggaccc
cagttcctgccgttcggcacctccacggtcggcagcgacaccatagcgccggcgctgcgg
gaggccgccgccgacgattcggtgtcggcgatcgtggtgcgcgtcaacagccccggcggc
tcggtcaccgcgtcggaaaccctgtggcgcgaggtgaaaaaggcccgcaaccggggcaag
ccggtggtggcgtcgatggggtcggtcgccgcctccggcggttactacatcgccgtggcg
gccgacgcggtcgtcgccagccccgcgacgatcaccggttcgatcggcgtgctcaccggc
aagctggtgatccgtgatctgctggggcggctgggcgtcggctcggacaccgtgcgcacc
aacgccaacgccgacgcctgggcgatcgacacgccgttcacgccggagcagcgcgcccac
cgggaggccgaggccgacctgctgtacgccgacttcgtggcgcgggtggccgacgggcgc
aacctgaccaaagacgccgtcgaccgggtcgcgcggggccgggtctggaccggcgccgac
gcgctggagcggggcctggtcgacgagctgggcgggttccgaaccgcgctgcggcgcgcg
aaaatccttgccggactggacgaggacgccgacgtgcgcatcgtcacctacccgggcggt
tcgctgctggacatgcttcggccccgggcgtcctcgcagccggccgccgcgtcgctgccc
gacgcgctgggggcgctgctgggccgcaccatcggcggcatcgtggacaacgtcgaacgg
tccgtcagcggcgccagcgcgctgtgggcggggccctggcggctctag

DBGET integrated database retrieval system