KEGG   Mycobacterium intracellulare ATCC 13950: OCU_43190Help
Entry
OCU_43190         CDS       T02158                                 

Definition
(GenBank) 50S ribosomal protein L6
  KO
K02933  
large subunit ribosomal protein L6
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:mia00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    OCU_43190
Ribosome [BR:mia03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    OCU_43190
  Bacteria
    OCU_43190
  Archaea
    OCU_43190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4549162..4549701)
Genome map
AA seq 179 aa AA seqDB search
MSRIGKQPVPVPAGVDVTIDGQKVSVKGPKGTLDLTVAEPITVARNDDGAIVVTRPNDER
RNRSLHGLSRTLVSNLVTGVTQGYTTKMEIFGVGYRVQLKGSNLEFALGYSHPVVIEAPD
GITFAVQSPTKFTITGIDKQKVGQISANIRRLRRPDPYKGKGVRYEGEQIRRKVGKTGK
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgtattggtaagcagccggttccggttcccgccggagtcgacgtaacgatcgac
ggtcagaaggtctcggtgaaaggccccaagggcacgctggatctgaccgtggccgagccg
atcaccgtggcgcgcaacgacgatggcgcgatcgtggtcacccgccccaacgacgagcgg
cgcaaccgctcgctgcacgggctgtcgcgcaccctggtgtccaacctggtcaccggcgtg
acgcagggctacaccaccaagatggagatcttcggtgtcggttaccgcgtgcagctcaag
ggctccaacctcgagttcgcgctgggctacagccatcccgtggtgatcgaggcgcccgac
ggcatcacgttcgccgtgcagtcgccgacgaagttcaccatcaccgggatcgacaagcag
aaggtcggccagatctcggcgaacatccgtcgtctgcgtcgccccgacccgtacaagggc
aagggcgtgcgctacgagggcgagcagatccgccgcaaggtcggaaagacaggtaagtaa

DBGET integrated database retrieval system