KEGG   Mycobacterium intracellulare ATCC 13950: OCU_43250Help
Entry
OCU_43250         CDS       T02158                                 

Definition
(GenBank) 13e12 repeat-containing protein
Organism
mia  Mycobacterium intracellulare ATCC 13950
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4551974..4553482)
Genome map
AA seq 502 aa AA seqDB search
MFDEVRRRAVIAELDELVERCHPSSTRESAALLEHLGVVARVENRAAAAQLVAIGELFAY
RLSRCAETEEWAVDTEAAVAAEVGAQLRIGQGLAASRVRYARAMRERLPKVGAVFGAGDI
DYRMFQTIVFRTDLIVDPEVLGAVDAVLAANVGRWPSLSQGRLAAQVDKVVAKADVDAVR
RRQERAAGRQVWMADMGDGLAHLEATLYAPDAHALDRRLDGLAATVCAHDPRTREQRRAD
ALGALAADADRLGCRCGRADCAAGGRAAGPVTVHVIGEHAVLEGRASTPGAEVGAEGLIP
PEVLAELAASATLVPLTHPGDAAPEPGYVPSRALADFVRCRDLTCRWPGCDRPATACDVD
HTIPYAAGGPTHASNLKALCRTHHLVKTFWGWQEKQLPDGTLIFTSPAGHTYVTTPGSAL
LFPSLCAATGAIAAPEADPPPNHCAQRTAMMPQRRRTRTQDRATRIAAERKHNRDARLAR
RAPSATCSWPTVYGPDDDPPPF
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgttcgatgaggtgcggcggcgtgcggtgatcgcggagcttgatgagctcgttgagcgt
tgtcatccgtcgtcgacgcgggagtcggcggcgttgttggaacacctcggggttgtggcg
cgggtggagaatcgggcggcggcggcgcagttggtggcgatcggggagttgtttgcctat
cggctctcgcgctgtgcggagaccgaggagtgggcggtggacaccgaggcggcggtggcc
gcggaggtgggcgcgcagttgcggatcggccaggggttggccgcgagtcgggtgcgctat
gcccgcgcgatgcgcgaacgcctgccgaaagtgggggcggtgtttggcgccggggatatc
gattatcggatgtttcagaccatcgtgttccgcaccgatttgatcgtcgatcccgaggtt
ctgggggcggtggacgcggtgttggcggccaatgtgggccggtggccgtcgttgagtcag
ggccggttggcggcccaggtcgacaaggtcgtggccaaggctgatgtggatgcggtgcgg
cggcgccaggagcgcgcggccggccggcaggtgtggatggccgacatgggtgatgggctg
gcgcatctggaggccaccctgtatgccccggatgcccatgccctggatcggcgcctggat
gggttggcggccacggtgtgtgcgcatgacccacggactcgggagcagcgccgcgctgat
gcattgggggcgttggccgccgacgccgatcggctggggtgtcgctgcgggcgcgcggat
tgtgcggccggggggcgggccgcgggcccggtgactgtccatgtgatcggcgaacacgcg
gtgctggagggtcgcgcatccaccccgggtgccgaggtcggcgccgagggattgatcccc
ccggaggtgctcgccgagctggcggcctcggccacactggtgccgttgacccatcccggc
gacgccgccccggagccggggtatgtgccctcgcgggcgctggccgattttgtgcggtgt
cgggatctgacgtgtcgctggcccggctgtgatcgcccggccaccgcctgcgatgtggac
cacaccatcccctacgccgccggtggccccacacacgcgtcgaacctcaaggcgctgtgc
cgtacgcatcatttggtgaaaacgttttggggctggcaggaaaagcagctgcccgatggc
acgctgatcttcacctccccggccgggcacacctatgtgaccaccccgggcagcgcgctg
ctgtttcccagcttgtgcgcggccaccggcgcgatcgcggcccccgaagccgacccgccc
ccgaaccactgcgcccagcgcaccgcgatgatgccccaacgccgccgcacccgcacccaa
gaccgcgccacccgcatcgcagcagaacgcaaacacaaccgcgacgcccggctggcccgg
cgggccccgtcggcgacctgctcctggcccaccgtctacggtcccgacgacgatccgccg
ccgttctag

DBGET integrated database retrieval system