KEGG   Mycobacterium intracellulare ATCC 13950: OCU_43260Help
Entry
OCU_43260         CDS       T02158                                 

Definition
(GenBank) hypothetical protein
Organism
mia  Mycobacterium intracellulare ATCC 13950
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FGE-sulfatase
Motif
Other DBs
NCBI-ProteinID: AFC45545
UniProt: H8IRL7
Position
complement(4553523..4554413)
Genome map
AA seq 296 aa AA seqDB search
MLSELVDLPGGSFRMGSTSFYPEEAPIHTVAVGPFAVERHPVTNAQFAEFVDATGYLTVA
EQPIDPALYSGADPDDLCPGAMVFRPTPGPVDLRDWRQWWQWVPGASWRHPFGPDSDVAD
RGDHPVVQVAYPDAAAYARWAGRRLPTEAEWEYAARAGSTTTYSWGDEVTSDGRLMANTW
QGSFPYRNDGALGWVGTSPVGTFAPNAFGLIDMIGNVWEWTATEFSPHHRLDSPPKACCT
PPGPADPSVSQTLKGGSHLCAPEYCHRYRPAARSPQSQDSATTHIGFRCVADSRSG
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
gtgctgagcgaactggtcgacctccccggcgggtcattccgcatgggctcgaccagcttc
tacccggaagaggcgccgatccatacggtcgccgtcggtccttttgcggtggaacggcac
ccggtgaccaatgcgcagttcgccgaattcgtcgacgccaccgggtatctcacggtggcc
gagcaaccgatcgacccggcgctgtactccggtgcggatcccgacgatctgtgcccgggc
gcaatggttttccggccgacgccggggccggtggacctgcgtgactggcgacagtggtgg
cagtgggtgccgggcgcgagctggcgtcatccgttcgggcccgacagcgacgtggccgac
cgcggcgatcacccggtggtgcaggtcgcctaccccgacgcggccgcctacgcgcgctgg
gcggggcggcggctgccgaccgaggccgagtgggagtacgcggcccgcgccggaagcacc
acgacgtactcgtggggtgacgaggtcaccagcgatggccggctgatggccaacacctgg
cagggcagcttcccctaccgcaatgacggggcgctcggctgggtggggacctcgccggtc
ggcacgtttgcgcccaacgcgttcggccttatcgacatgatcggcaacgtctgggaatgg
accgccaccgaattctcgccgcaccaccggctcgattcgccgcccaaggcctgctgcacc
ccgccgggccccgccgacccgtccgtcagccagacgttgaagggcggcagccacctgtgc
gcgccggagtactgccaccgataccggccggcggcccggtccccgcaatcgcaggactcc
gcgaccacccacatcgggtttcgctgcgtggcggattcgcggtcaggctag

DBGET integrated database retrieval system