KEGG   Mycobacterium intracellulare ATCC 13950: OCU_43270Help
Entry
OCU_43270         CDS       T02158                                 

Definition
(GenBank) arylsulfatase
  KO
K01130  
arylsulfatase [EC:3.1.6.1]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Brite
KEGG Orthology (KO) [BR:mia00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    OCU_43270
Enzymes [BR:mia01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.6  Sulfuric-ester hydrolases
    3.1.6.1  arylsulfatase
     OCU_43270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4554482..4556842)
Genome map
AA seq 786 aa AA seqDB search
MSTDSRAFNGKIELDIRDSEPDWGPYAAPTAPQDAPNVLYLVWDDTGIATWDCFGGLVEM
PAMSRIAERGVRLSQFHTTALCSPTRASLLTGRNATTVGMATIEEFTEGFPNANGRIPFD
TALLSEALAEAGYNTYCVGKWHLTPLEESNLASTKRHWPLSRGFERFYGFLGGETDQWYP
DLVYDNHPVSPPATPEDGYHLSKDLADKTIEFIRDAKVIAPEKPWFSYVCPGAGHAPHHV
FKQWADHYAGRFDMGYERYREIVLERQKSMGIVPGDTELSPVNPYLDVKGPDGQEWPLQD
TVRPWDSLNDDEKRLFSRMAEVFAGFLSYTDAQIGRILDYLEESGQLDNTIIVVISDNGA
SGEGGPNGSVNEGKFFNGYIDTVEESMKLFEHLGGPQTYNHYPIGWAMAFNTPYKLYKRY
ASHEGGIADTAIISWPNGIAAHGEVRDNYVNVCDITPTVYDLLGLTPPQTVKGIAQKPLD
GVSFKAALDDPKATTGKSAQFYTMLGTRGIWHEGWFANTVHAATPAGWSHFDADRWELFH
IEADRSQCHDLAAQKPEKLEELKALWFSEAAKYNGLPLSDFNILETLGRSRPYLVGERSS
YVYYPDCADVSIGAAAEIRGRSFSVLAEVTIDTTGAEGVLFKQGGAHGGHVLFIQDGRLH
YVYNFLGERQQEVSSAQAVPLGRHLFGASYSRTGTVENSHTPLGDLTLFIDDEVVGTLAG
VSTHPGTFGLAGAGITVGRNGGSGVSSRFKAPFAFTGGTIAQVTVDLSGRPYRDVETEIA
LAFSRD
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atgtccactgactcgcgagccttcaacggcaagatcgagctcgatatccgcgattccgaa
ccggattggggtccctacgccgcgccgaccgcgccgcaggatgcaccgaacgtcctctat
ctggtttgggatgacaccggcatcgcgacctgggactgcttcggcggcctggtcgagatg
ccggccatgtcgcgcatcgccgaacgcggcgtccggctttcgcagtttcacaccaccgcg
ctgtgttcgccgacccgggcgtcgctgctcaccgggcgcaatgccacgaccgtcggcatg
gccaccatcgaggagttcaccgagggcttccccaacgccaacggtcgcatcccgttcgac
accgccctgctgtccgaggccctcgccgaggcgggatacaacacctactgcgtgggcaag
tggcacctgacgccgctggaggaatcgaacctggcgtcgacgaagcggcactggccgctc
tcgcgcggcttcgaacggttctacgggttcctgggcggggagaccgaccagtggtatccc
gacctggtgtacgacaaccatccggtcagcccgccggccaccccggaggacggctaccac
ctgtcaaaggacctcgccgacaagacgatcgaattcatccgcgacgccaaagtgattgcg
ccggaaaagccgtggttctcctacgtgtgccccggcgccgggcacgcgccgcatcacgtc
ttcaagcaatgggccgaccactacgccggccgcttcgacatgggctacgagcgctaccgc
gagatcgtgctggagcggcagaagtcgatgggcatcgtgccgggcgacaccgaactgtcg
ccggtcaacccgtacctcgacgtgaagggtcccgacggccaggagtggcccctgcaggac
acggtgcgaccctgggattccctgaatgacgacgagaagaggctgttttcccggatggcc
gaggtgttcgccgggttcctgagctacaccgacgcccagatcggccggatcctggactat
ctcgaggaatcgggtcagctcgacaacaccatcattgtggtgatctccgacaacggcgcc
agcggcgagggcgggcccaacggatcggtcaacgagggcaagttcttcaacggctacatc
gacacggtcgaagaaagcatgaagctgttcgagcatctcggcgggccgcagacctacaac
cactacccgatcgggtgggcgatggcattcaacacgccctacaagctctacaagcgctac
gcctcccacgagggcgggatcgccgacaccgcaatcatctcctggcccaacgggattgcc
gcgcacggcgaggtccgcgacaactacgtcaacgtctgcgacatcacgccgaccgtctac
gacctgctcggcctgacgccgccgcaaaccgtcaagggcatcgcacagaaaccactggac
ggcgtgagtttcaaagcggcacttgacgatccgaaggccaccaccggcaaaagcgcccag
ttctacaccatgctgggtacccgcgggatctggcacgagggctggttcgccaacaccgtg
cacgcggccacaccggccggctggtcgcatttcgacgccgatcgctgggagctgttccac
atcgaggccgaccgcagccagtgccacgacctcgcggcccaaaagccggagaaactcgag
gaactcaaggcgttgtggttctcggaggccgccaaatacaacgggctgcccctctcggat
ttcaacatcctggagaccctggggcgctcgcggccgtatctggtcggcgaacggtccagc
tacgtctactatcccgattgcgcggacgtgagcatcggcgcggccgccgagatccgcggc
cgctcgttttcggtgctggccgaggtgaccatcgataccaccggcgccgagggtgtgctg
ttcaagcagggcggcgcgcacggcgggcacgtgttgttcatccaggacgggcggctgcat
tacgtgtacaacttcctcggcgagcgccagcaggaggtctcctcggcgcaggccgtgccg
ttgggcaggcatctgttcggcgccagctattcgcggaccggcacggtcgagaacagtcat
acgccgctgggtgacctgacgctgttcatcgatgacgaggttgtcggcacgctcgccggg
gtgagcacccaccccggcaccttcgggctggcgggcgccggcatcaccgtcggtcgcaac
ggcgggtcgggtgtgtccagtcgcttcaaggcgccgttcgcgttcaccggcgggaccatc
gcccaggtcaccgtcgacctgtccggccggccctatcgggacgtggaaaccgagatcgcg
ctggccttttcgcgcgactga

DBGET integrated database retrieval system