KEGG   Mycobacterium intracellulare ATCC 13950: OCU_43360Help
Entry
OCU_43360         CDS       T02158                                 

Definition
(GenBank) 50S ribosomal protein L4
  KO
K02926  
large subunit ribosomal protein L4
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:mia00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    OCU_43360
Ribosome [BR:mia03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    OCU_43360
  Bacteria
    OCU_43360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4560819..4561490)
Genome map
AA seq 223 aa AA seqDB search
MAAQGSKTLKIDVKTPAGKVEGSIELPAELFDAPANIALMHQVVTAQRAAARQGTHSTKT
RGDVSGGGRKPYRQKGTGRARQGSTRAPQFTGGGVVHGPKPRDYSQRTPKKMIAAALRGA
LSDRARNGRIHAVTEIVAGQTPSTKSARAFLGTLTERKQVLVVIGRSDEAGAKSVRNLPG
VHILTPGQLNTYDVLRSDDVVFSVEALNAYISANTGTPEEVSV
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggcagcacaaggttccaagacgctcaagatcgacgtcaagacaccggccggcaaggtc
gaaggctcgatcgagttgccggccgaattgttcgacgccccggccaatatcgcgctgatg
caccaggtcgtcaccgcccagcgggcggcggcgcgccagggcacgcactcgaccaagacg
cgcggcgacgtcagcggcggtggccgtaagccctaccggcagaagggaaccggccgcgcc
cggcagggttccacgcgggccccgcagttcaccggcggtggcgtcgtgcacggccccaag
ccgcgtgactacagccagcgcacgcccaagaagatgatcgccgcggcgttgcgcggtgcg
ctgtccgaccgggcgcgcaacgggcgcatccacgcggtcaccgaaatcgtcgccggccag
accccgtcgaccaagagcgccagggcgttcctgggcacgctgaccgagcgcaagcaggtg
ctggtcgtgatcggacgcagcgacgaggcgggcgccaagagcgtgcgcaaccttcccggt
gtgcacatcctgacgcccggccagctcaacacctatgacgtgctccgctccgacgacgtg
gtgttcagcgtggaggccctcaacgcctacatcagcgccaacaccggtactcccgaggag
gtttcggtctga

DBGET integrated database retrieval system