KEGG   Mycobacterium intracellulare ATCC 13950: OCU_43380Help
Entry
OCU_43380         CDS       T02158                                 

Definition
(GenBank) 30S ribosomal protein S10
  KO
K02946  
small subunit ribosomal protein S10
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:mia00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    OCU_43380
Ribosome [BR:mia03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    OCU_43380
  Bacteria
    OCU_43380
  Archaea
    OCU_43380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4562158..4562463)
Genome map
AA seq 101 aa AA seqDB search
MAGQKIRIRLKAYDHEAIDASARKIVETVVRTGASVVGPVPLPTEKNVYCVIRSPHKYKD
SREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNIQ
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
gtggcgggacagaagatccgcatcaggcttaaggcctacgaccatgaggctatcgacgcg
tcggcgcgcaagatcgtcgagaccgtcgtccgcacgggtgccagcgtcgtagggccggtg
ccgctgccgaccgagaagaatgtgtattgcgtcatccgctctccgcacaagtacaaggac
tcgcgggagcacttcgagatgcgcacgcacaagcggctgatcgacatcctcgacccgacg
ccgaagaccgttgacgcgctgatgcgcatcgaccttccggccagtgtcgacgtcaacatc
cagtag

DBGET integrated database retrieval system