KEGG   Mycobacterium intracellulare ATCC 13950: OCU_43390Help
Entry
OCU_43390         CDS       T02158                                 

Definition
(GenBank) cytochrome P450 family protein
Organism
mia  Mycobacterium intracellulare ATCC 13950
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4562889..4564181
Genome map
AA seq 430 aa AA seqDB search
MAGAEAKTSAMSTPTVDPETAQAVKVFADPIAYADEPRLHAALAHLRAHAPVSLVDCPPY
RPFWAITKHADVMEIERANDLFLNEPRPLLAPAEADDFARAQLDAGMGLRTLIHMDDPRH
RVVRAIGADWFRPKAMRALKVRVDELAKSYVDKMMAAGGECDFVQEVAVNYPLYVILSLL
GLPESDFPRMLRLTQELFGGDDEEFKRGTTPEEQMQILLDFFGYFSDLTAARRAHPTDDL
ASAIANARVDGEPLSDVDTASYYVIIATAGHDTTSATIAGGLQALIENPDQRARLTADPA
LMPLATEEMIRWVTPVKEFMRTAVADTAVRGVPIAAGESVYLSYVSANRDEDVFDDPFRF
DVGRDPNKHLAFGYGVHFCLGAALARMEVNSFFTELLPRLESVECAGEPELVATTFVGGL
KHLPIRYSLR
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggccggtgccgaggccaagactagtgccatgagcacaccgaccgtcgatccggaaacc
gcgcaggccgtcaaggtgttcgccgaccccatcgcgtacgccgacgagccgcggctgcat
gcggcgctggcgcacctgcgcgcgcacgcaccggtgtcgttggtcgactgtccgccgtac
cggccgttctgggcgatcaccaagcacgccgacgtcatggagatcgagcgggccaacgac
ctgttcctcaacgagccgcggccgctgctggcccccgccgaggccgacgacttcgcgcgc
gcccagctggacgccgggatgggcctgcgcaccctgatccacatggacgacccccggcac
cgggtggtgcgcgcgatcggtgccgactggtttcgccccaaggccatgcgcgcgctgaag
gtcagggtcgacgagctggccaagagctacgtcgacaagatgatggccgcgggcggcgaa
tgcgatttcgtgcaggaggtcgccgtgaactacccgctgtacgtgatcttgtcgctgctg
ggcctgccggaatcggatttcccgcgcatgctcagactcacccaggaactgttcggcggc
gacgacgaggagttcaagcggggcaccacgcccgaggagcagatgcagatcctgctcgac
ttcttcggctacttcagcgatctcaccgcggcgcggcgggcccaccccaccgacgacctg
gcgtcggcgatcgccaacgcgcgcgtcgacggcgagccgctgtcggacgtcgacacggcc
tcctactacgtcatcatcgcgaccgccgggcacgacaccacgagcgccaccatcgccggc
gggctgcaggcgctgatcgaaaaccccgaccagcgcgcccggttgaccgccgaccccgca
ctgatgccgctggcgaccgaggagatgatccgctgggtgacgccggtcaaagagttcatg
cgcaccgcggtcgccgacaccgccgttcgcggggtgccgatcgccgcgggcgaatcggtg
tatctgtcctacgtgtcggcgaaccgcgacgaggacgtgttcgacgacccgttccggttc
gatgtcggccgagaccccaacaagcacttggcctttggctacggcgtgcacttctgcctg
ggggccgcgctggcccgcatggaggtgaacagctttttcaccgaactgttgccccggctg
gagtccgtcgagtgcgccggggaacccgaactcgtcgccaccacgttcgtgggtggtctc
aagcacctgccgattcggtattcgctgcgttag

DBGET integrated database retrieval system