KEGG   Mycobacterium intracellulare ATCC 13950: OCU_43480Help
Entry
OCU_43480         CDS       T02158                                 

Definition
(GenBank) hypothetical protein
Organism
mia  Mycobacterium intracellulare ATCC 13950
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4571505..4572098
Genome map
AA seq 197 aa AA seqDB search
MPQPRVGRRRSTTPAHITDVAIDLFTARGFADVSVDDVAHAAGISRRTLFRYYASKNAIP
WGDFDTHLAHLRDLLDNVDSRVRLGDALRAALLAFNTFDESETARHRQRMRVILQTAELQ
AYSMTMYAGWREVIAGFVARRCDCKTTDLLPQTAAWTMLGVALSAYEHWLSDESVPLPVA
LGNAFDVVGAGLNELDT
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagccgcgggtgggcaggcgccgctcgaccacgccggcccatatcaccgacgtg
gccatcgacctgttcaccgcccgcggtttcgccgacgtgagcgtcgacgacgtcgcccac
gccgccggcatctcccgccgcacgctctttcgctactacgcgtccaagaacgccatcccg
tggggcgatttcgacactcacctcgcccacctccgcgacctgctcgacaacgtggattcc
cgggtgcgcctgggcgatgccctgcgcgcggcgttgttggcgttcaacacctttgacgag
tccgagaccgcccgccatcgccagcgcatgcgggtgatcctgcaaaccgctgagctgcag
gcctattcgatgacgatgtacgccggctggcgcgaggtgatcgccgggttcgtggcccgc
cgctgcgattgcaagacaaccgacctgctgccgcagaccgccgcctggacgatgctgggg
gtggcgctgtcggcctacgaacactggctcagcgatgagtccgtcccgctgccggtcgcc
ctgggcaatgccttcgacgtggtcggcgcggggctcaacgagctggacacttga

DBGET integrated database retrieval system