KEGG   Mycobacterium intracellulare ATCC 13950: OCU_43490Help
Entry
OCU_43490         CDS       T02158                                 

Definition
(GenBank) hypothetical protein
Organism
mia  Mycobacterium intracellulare ATCC 13950
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4572095..4573138
Genome map
AA seq 347 aa AA seqDB search
MSVEHLAHTLRAQGRFCASSGSAMYGELFELVAADVEAGGVFAAILSRHRHAPSRDAVPL
RLLGGLHRLVLDGRAAHLRRWYPSTGGSWNAGPAWPQIRDAAAGHADALRAALDQPPQTN
EVGRSAALIGGLLHLKQSGLPIRLFEIGSSAGLNLRADHYLYRFAGSQWGPPDSPVAIDD
AWRGALPPGRDVRIAERCGYDIAPIDVGDTDGELTVLSYVWPDQAARLARLRGAIEVARR
VPARLERRTAAGAVAGLRVADGALTVLWHSITWQYLSADERDAVRAHVDALAARAGARSP
FAHLTMEPASDGPGAPIRFEVCARSWPDGESRVLGECHPHGPPVHWR
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgtcgagcacctggcgcacacgctgcgcgcccagggcaggttctgcgcctcgtcg
ggctccgcgatgtacggcgagctgttcgagctggtggccgccgacgtcgaagccggcggc
gtgttcgcggccatcctgtcccggcaccgccacgccccctcgcgcgacgcggtgccgctt
cgactgctcggcgggctgcaccggctggtgctcgacggccgggcggcgcacctgcgccgc
tggtaccccagcaccggcgggagctggaacgccggaccggcctggcctcagatccgcgac
gccgcggccggccacgccgatgcgctgcgcgcggcgctggatcaacccccgcagaccaac
gaggtgggtcgatcggccgcactgatcggcggcttgctgcacctcaaacaatccggtttg
ccgataaggcttttcgagatcgggtcgagcgcggggctgaacctgcgagccgaccactac
ctttaccggttcgccgggagccagtgggggccgcccgactcgccggtggccatcgacgac
gcgtggcgcggcgcgctgccgcccgggcgtgacgtgcggatcgccgagcggtgtggctac
gacatcgcgccgatcgacgtcggcgacaccgacggggagctgaccgtgctgagctacgtc
tggcccgaccaggccgcgcggctggcccggctgcgcggggccatcgaggtggcccgccgg
gtcccggcccggctcgaacgccggacggcggccggcgcggtcgccggtctgcgggtggcc
gacggcgcgctcaccgtcctctggcattccatcacctggcaatacctgtcggccgacgag
cgcgacgccgtgcgcgcccacgtggacgcgctggccgcacgggccggcgcgcgctcaccg
ttcgcccacctcacgatggagccggcgagcgatgggcccggcgccccgatcaggttcgag
gtgtgcgcccgcagctggccggacggcgaatcgcgcgtgctgggcgaatgccacccgcac
ggcccgccggtgcactggcggtaa

DBGET integrated database retrieval system