KEGG   Mycobacterium intracellulare ATCC 13950: OCU_43510Help
Entry
OCU_43510         CDS       T02158                                 

Definition
(GenBank) hypothetical protein
Organism
mia  Mycobacterium intracellulare ATCC 13950
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4574092..4574247
Genome map
AA seq 51 aa AA seqDB search
MGFLRRKRFRDNTPGGLCQPLLVRMGPIHRSLGDNNRAGRTAPGPRRSTSH
NT seq 156 nt NT seq  +upstreamnt  +downstreamnt
gtggggtttcttcgacgtaaacgattcagggacaacacaccaggcggcttatgccaaccc
cttctggtgcgtatgggccccatacatcgttcgcttggtgacaataaccgagccgggcgg
acggcgcccggaccgaggcggtcgacgtcgcattag

DBGET integrated database retrieval system