KEGG   Mycobacterium intracellulare ATCC 13950: OCU_43530Help
Entry
OCU_43530         CDS       T02158                                 

Definition
(GenBank) hypothetical protein
Organism
mia  Mycobacterium intracellulare ATCC 13950
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4575464..4576651)
Genome map
AA seq 395 aa AA seqDB search
MSTDASATNGIVIVGGGLAAARTAEHLRKSAYSGPITLVSDEVHLPYDRPPLSKEVLRKE
VDDTALKPREWYDENDITLRLGSAATSLDTAAQTVTLDDGTTLRYDELVIATGLVPRRIP
SIPDLEGIRVLRSFDESLALREHASAAQRAVVIGAGFIGCEVAASLRSLGVDVVLVEPQP
TPLAAVLGEQIGELVARLHRAEGVDVRLGVGVAEVRGDTRVEAVVLSDGTELAADVVVVG
IGSRPATEWLEGSGVDVDNGVICDEAGRTSAPNVWALGDVASWRDATGHQGRVEHWSNVA
DQARAVVPAMLGQDVPTAVVVPYFWSDQYDVKIQCLGEPEADDIVHVVEDDGRKFLAYYE
RDGALAGVVGGGMPGKVMKMRAKIAAAVPISEVLG
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
gtgagtactgacgcgagcgccaccaacggaatcgtgatcgtcggcggcggattggccgcc
gcccgcaccgccgagcacctgcggaaatcggcgtattccgggcccatcacgctcgtcagc
gacgaggtccacctgccgtatgaccgcccgccgctgtcgaaagaggtgttgcgcaaagag
gtcgacgacaccgcgctcaaaccgcgcgagtggtacgacgagaacgacatcaccctgcgg
ctgggatcggccgcgacaagcctggacaccgcggcgcagacggtgacgctcgacgacggg
acgacgcttcgctacgacgaactcgtcatcgccaccgggctggtaccgcgacgcatcccg
tcgatccccgacctcgagggcatccgggtgctgcgctcgttcgacgagtccctggcgctg
cgcgagcacgcgtccgcggcgcagcgcgccgtcgtcatcggcgccggcttcatcggctgc
gaggtggcggccagcctgcgcagcctgggggtggacgtggtgctggtggagccccagccc
actccgctggccgcggtgctcggcgaacagatcggtgagctggtggcccggctgcaccgc
gccgaaggcgtcgacgtccggctcggggtcggcgtggcggaggtgcgcggtgacacgcgc
gtcgaggcggtggtgttgagcgacggcaccgagttggcggccgacgtggtggtggtcggc
atcgggtcgcgcccggcgaccgaatggctcgagggcagcggagttgacgtcgacaacggc
gtcatctgcgacgaggccgggcgcaccagcgcgccgaacgtgtgggcgctcggggacgtc
gcgtcgtggcgtgacgcgacgggacaccaagggcgcgtggaacattggagcaatgtcgcc
gatcaggcccgcgccgtggtgcccgcgatgctggggcaggacgtgcccaccgcggtggtg
gttccctacttctggagcgaccaatacgacgtcaagatccagtgcctgggtgagccggag
gccgacgacatcgtgcacgtcgtcgaggacgacggtcgcaagttcctggcctactacgaa
cgcgacggcgccctggcaggcgtggtcggcggcgggatgcccggcaaggtcatgaagatg
cgcgccaaaatcgctgcggccgtgcctatttcggaagtgctgggctga

DBGET integrated database retrieval system