KEGG   Mycobacterium intracellulare ATCC 13950: OCU_43630Help
Entry
OCU_43630         CDS       T02158                                 

Definition
(GenBank) hypothetical protein
Organism
mia  Mycobacterium intracellulare ATCC 13950
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4584871..4585248
Genome map
AA seq 125 aa AA seqDB search
MKWTTVAGSLATCAVAVVAGFAAVPGLAQAKNGDTHVIGEDMEQTVDCNDATLLVNGSFL
TVTALGNCYAVTVMGSSNVVIADSVSHDITVYGHDQTVLYKGGQPFLWDRGRELGMTNRL
QQVPG
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtggacaactgtcgccgggtcgttggccacgtgcgccgtcgccgtcgtcgccggt
ttcgccgccgtgccgggccttgcgcaggccaagaacggcgacacccatgtcatcggggag
gacatggagcagacggtcgactgcaacgacgccacgctgctggtcaacggctcgttcctg
acggtcaccgcgctgggcaactgctacgccgtgacggtgatgggttcgtcgaatgtcgtt
atcgccgactcggtttcgcacgacatcacggtgtacggccacgaccagaccgtgctctac
aagggtggtcagccgttcctgtgggaccggggccgcgaactgggcatgaccaaccggctc
cagcaggtgccgggctga

DBGET integrated database retrieval system