KEGG   Mycobacterium intracellulare ATCC 13950: OCU_43680Help
Entry
OCU_43680         CDS       T02158                                 

Definition
(GenBank) putative acyl-CoA dehydrogenase
  KO
K09456  
putative acyl-CoA dehydrogenase
Organism
mia  Mycobacterium intracellulare ATCC 13950
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4588200..4589828)
Genome map
AA seq 542 aa AA seqDB search
MSDTHVVTNQVPPLEDHNPATSAVLIEALIREGGQWGLDEVNEVGALSASREAQRWGELA
DRNRPILHTHDRNGHRIDEVEYDPAYHELMRAAITHGMHAAPWADERPGAHVVRAAKTSV
WTVEPGHVCPISMTYAVVPALRYNPELAKVYEPLLTSREYDPELRPATAKPGITAGMSMT
EKQGGSDVRAGTTQATPNADGTYSLTGHKWFTSAPMCDIFLVLAQAPGGLSCFMLPRVLP
DGTRNRMFLQRLKDKLGNHANASSEVEYDGAIAWLVGEEGRGVPTIIEMVNLTRLDCTLG
SATSMRTGLTRAIYHAQHRKAFGAYLIDQPLMRNVLADLAVEAEAATMVAMRMAGATDKA
VRGDETEALLRRIGLAASKYWVCKRSTPHAAEALECLGGNGYVEDSGMPRLYREAPLMGI
WEGSGNVSALDTLRATATRPECVEVLFDEIAESAGQDPRLGNHVARLRADLANLETIAYR
GRKVAEDICLALQGSLLVRHGHPAVAEAFLTTRLDRRWGGAFGTMPDGLDLAPILERALV
KG
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacacccatgtcgtcaccaaccaggtcccgcccctggaagaccacaaccccgcc
acctcggcggtgctcatcgaggccctgattcgcgagggagggcagtggggcctggacgag
gtgaacgaggtcggcgccctgtcggccagccgcgaggcgcagcgctggggcgagctcgcc
gatcgcaaccggcccatcctgcacacccacgaccgcaacggtcaccggatcgacgaggtc
gaatacgacccggcgtaccacgagctgatgcgcgcggcgatcacccacggcatgcacgcc
gcgccctgggccgacgagcggccgggtgcgcacgtcgtgcgggccgccaagacctcggtg
tggacggtcgaaccggggcacgtctgcccgatctcgatgacgtatgccgtggtgcccgcg
ctgcgctacaaccccgagctagccaaggtctacgagccgctgctgacctcccgcgaatac
gacccggaactccggccggccaccgccaagcccggcatcacggcgggcatgtcgatgacc
gagaagcagggcggctccgacgtgcgcgccggcaccacgcaggccacccccaacgccgac
ggcacctacagcctgacgggccacaagtggttcacctcggcgccgatgtgtgacatcttc
ctggtgctcgcgcaggcgcccggagggttgtcgtgcttcatgctgccgcgcgtgctgccc
gacggcacccgcaaccggatgtttttgcagcgcctcaaggacaagctcggcaaccacgcc
aacgcctcgagcgaggtcgaatacgacggcgcgatcgcgtggctggtgggcgaggagggc
cgcggcgtgccgaccatcatcgagatggtcaacctcacccggctggactgcacgctgggc
agcgccaccagcatgcgcaccggtttgacccgcgcgatctaccacgcccagcaccgaaag
gccttcggcgcctacctcattgaccagccgctgatgcgcaacgtgctggccgatttggcc
gtcgaggcggaggcggccaccatggtcgcgatgcggatggccggcgccaccgacaaggcg
gtgcgcggcgacgagaccgaggcgctgctgcgccggatcggcctggccgccagcaagtac
tgggtgtgcaagcgctccaccccgcacgccgccgaagccttggaatgcctgggcggcaac
ggctatgtggaggactccggcatgccgcggctgtaccgggaggcgccgctgatgggcatc
tgggagggctcgggcaacgtcagcgcgctggatacgttgcgcgctaccgcaactcgtccc
gaatgcgtcgaggtgctgttcgacgaaatcgccgagagcgcgggccaggacccgcgcctg
ggcaaccatgtcgcgcggctgcgcgccgacctggccaacctggagaccatcgcctaccgc
ggccgcaaggtcgccgaggacatctgcctggcgctgcagggctcgctgctggtgcgccac
gggcaccccgccgtcgccgaggcgttcctgacgacccggctcgaccgccggtggggcggc
gcgttcggcaccatgcccgacgggctcgacctcgcgccgattctcgagcgtgctctagta
aagggatga

DBGET integrated database retrieval system