KEGG   Mycobacterium intracellulare ATCC 13950: OCU_43700Help
Entry
OCU_43700         CDS       T02158                                 

Definition
(GenBank) endonuclease IV
  KO
K01151  
deoxyribonuclease IV [EC:3.1.21.2]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:mia00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    OCU_43700
Enzymes [BR:mia01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.2  deoxyribonuclease IV
     OCU_43700
DNA repair and recombination proteins [BR:mia03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    AP endonucleases
     OCU_43700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4590743..4591498)
Genome map
AA seq 251 aa AA seqDB search
MLIGSHVHQDDPLAAAQADGADVVQFFLGNPQSWKKPKPRDDAEALKASTIPLYIHAPYL
INVASANNRVRIPSRKILQDTCDAAAAINATAVIVHGGHADDNDMDAGFERWVKALDYLE
TDVPVYLENTAGGDHAMARHFDTIGRLWDHIGDKGIGFCLDTCHAWAAGEQLIDAVDRIK
ALTGRIDLVHCNDSRDAAGSGADRHANFGTGQIDPELLAAVVKAADAPVICETADEGRKD
DIAFLREKTGG
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
gtgctcatcggttcgcatgtccaccaggatgacccgctggccgccgcgcaggccgacggc
gccgacgtcgtccagttcttcctcggcaacccgcagagctggaagaagcccaagccgcgt
gacgacgccgaggcgctcaaggcgtcgaccatcccgctctacatccacgcgccctacctg
atcaacgtggcctcggccaacaaccgggtccgcatcccgtcgcgcaagatcctgcaggac
acctgcgacgcggccgcggcgatcaacgcgacggcggtgatcgtgcacggcggccacgcc
gacgacaacgacatggacgccggcttcgaacggtgggtcaaggccctggactacctggaa
acggacgtgccggtctacctggagaacaccgccggcggcgaccacgcgatggcccgccac
ttcgacaccatcggccggctgtgggatcacatcggcgacaagggaattgggttctgcctg
gacacctgccacgcctgggccgccggcgagcagctgatcgacgcggtcgaccgcatcaag
gcgctgaccggccgcatcgacctggtgcactgcaacgactcgagggacgcggcgggctcc
ggcgccgaccggcacgccaacttcggcaccggccagatcgatcccgagctgctcgccgcg
gtggtcaaggccgccgacgccccggtgatctgcgaaaccgccgacgagggccgcaaggac
gacatcgcgttcctgcgggagaaaacgggcggctga

DBGET integrated database retrieval system