KEGG   Mycobacterium intracellulare ATCC 13950: OCU_43800Help
Entry
OCU_43800         CDS       T02158                                 

Definition
sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:mia01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mia00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mia00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mia00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mia00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:mia00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4604892..4605812)
Genome map
AA seq 306 aa AA seqDB search
MPTLCLDIGGTKIAAALVDSAGALVHSAIRPTPVTTAAGDVWAVVEAMIADAVRAADAPI
TAVGIASAGPIDLHTGSVSPINIAGWDRFPLRDRVAAAVPGVPVVLGGDGLCMALGEHWI
GAGRSAGPDARFLLGMVVSTGVGGGLVLDGVPYAGRTGNAGHVGHIVVELDGPPCTCGGR
GCVETVASGPWMVRWARDNGWAAPPGAGARDLAVAAAAGDPVARRAFHRSANALAAMIAS
VGAVCDLDLVVIGGGVSKSGPLLFDPLRAKLADYAGLDFLSGLRVVPGELGGAAGLIGAA
RLAALG
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgccaaccctctgcctggacatcggcggcaccaaaatcgccgccgctctggtcgattcg
gccggcgcgctggtgcacagcgcgatccgccccaccccggtcacgaccgccgccggcgac
gtgtgggccgtcgtcgaggcgatgatcgccgacgcggtgcgcgcggccgacgccccgatc
accgccgtcggcatcgcctcggccgggccgatcgacctgcacaccggatcggtcagcccg
atcaacatcgcgggctgggaccgtttcccgctgcgcgacagggtcgccgccgcggtgccc
ggggtgccggtggtgctgggcggcgacggcctgtgtatggcgttgggcgagcactggatc
ggggcgggccgcagcgcggggccggacgcccggttcctgctgggcatggtggtctccacc
ggggtgggcggcggtctggtgctcgacggcgtcccctacgccgggcgcaccggcaacgcc
ggccacgtcgggcacatcgtcgtcgaactggacgggccgccgtgcacgtgcggcggccgc
ggctgcgtggagacggtggcgtccgggccgtggatggtgcgctgggcgcgcgacaacggg
tgggcggcgccgcccggcgcgggcgccagggacctggccgtcgcggcggcggccggagac
ccggtggcccggcgggcctttcaccgatcggccaacgcgctcgccgcgatgatcgcctcg
gtcggcgcggtctgcgatctggacctcgtcgtgatcgggggaggggtgtccaaatccggg
ccgctgctcttcgaccccctgcgggcgaagctggccgactacgcggggctggacttcctg
tccgggctgcgggtggtgcccggcgagctcggcggtgcggccggcctgatcggcgcggcc
cgcctcgcggccctgggctga

DBGET integrated database retrieval system