KEGG   Mycobacterium intracellulare ATCC 13950: OCU_43820Help
Entry
OCU_43820         CDS       T02158                                 

Definition
(GenBank) hypothetical protein
Organism
mia  Mycobacterium intracellulare ATCC 13950
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_38 NPCBM_assoc Glyco_hydro_38C Alpha-mann_mid
Motif
Other DBs
NCBI-ProteinID: AFC45601
UniProt: H8ISF6
Position
complement(4606431..4610612)
Genome map
AA seq 1393 aa AA seqDB search
MQLVSAESTELFVGPPEAPLQLARVTVAGVGEPRRVRIDGDGLTGEAVADIGDELVEVPV
TVDRPVVGERRSARVRAGRADMPFEFTVAEPGWTMFMVSHFHYDPVWWNTQGAYTSEWTE
DPPGRARQTNGFELVHAHLEMARREPEYKFVLAEVDYLKPYWDTRPEDRADLRRFIAQGR
VEVLGGTYNEPNTNLTSPETTIRNLVHGMGFQRHVLGADPATAWQLDVFGHDPQFPGLAA
DAGLTSSSWARGPHHQWGPMHSDGGLGGMQFCSEFEWISPSGRGLLTHYMPAHYSAGWWM
DSATTLREASDATYELFDQLKTVALTRNVLLPVGTDYTPPNTWVTAIHRDWAARYTWPRF
VCALPREFFAAVRAELAQRGCEPSPQTRDMNPIYTGKDVSYIDTKQANRAAENAVLAAER
FAVFAALATGADYPHAALAKAWVQLAYGAHHDAITGSESDQVYLDLLTGWRDAWELGRAA
RDASLALLSGAIEGDVVVWNPLAHPRTDLVTARIDPPLPAGVQVLDADGAELPALVQHDG
SSVTWLARDVGSLGWRAYRLAPADQAAGWAAVPGSVIANEHYRLEVDAARGGAVASLIDL
SAQGGRELIAEGRVGNELAVYEEYPSHPTQGEGPWHLLPKGPVVCSSESPARVRAFRGPL
GERVVVRGRIGTLLRYTQTLTLWRGVARVDCRTTIDDFTGADQLVRLRWPCPVPGAMPVS
EVGDAVVGRGFALLHDGPRAVDTARHLWALDNPAYGWFGLSSAARVRVSGAGVRAISVAE
VVSPAEAVSGPLARELMVALVRAGVTATCTAADKPRYGHLEVDSNLPDVRIALGGPDRNA
FTEAVLAHADPVYAGELDRQLAATGRARVWVPAETPLAAVWVPGADLRGLRALPVLVVDG
RADEDLRAEIAALADDLGDAEIVVAQRPASGTEAFEDRTVALLNRGVPSFAVDTEGTLHT
ALMRSCTGWPSGIWIDDPRRTAPDGSNFQLQHWTHDFDYALVSGDGDWRRADIPTRSAQF
AQPLLAVAGGRRPGALPPAGALLRVEPADSVHLAALKAAGDPLTAGRAAPVDPHSVALRL
VETTGAGARVTLSSDVAAISDLRAADLLEAPEGRLDSVDLHGYQVATVLARFDLPATLSD
AAALAPNAEAAQPLYARYWLHNRGPAPLGGLPAVAHLHPSQISAQPGRDVTVRLTAASDC
SDATLRGGVVLACPDGWSATPAELPFTLCSGGHLEADVVVSIPPTAEPGLYPVRARLRLT
GEHIPAPWRQAVEDVCVVAVGGAAVDPGGLVYLADGPREVTLRPGEAGEVTVTVGTHARA
DLALEAHLISPWGTWEWMGPAALGAVLPAGGTVGLGFRVTPPAWLGPGQWWALVRIGCAG
RLVYSPAVRVTVT
NT seq 4182 nt NT seq  +upstreamnt  +downstreamnt
atgcagctggtttcggcggagtcgacggagcttttcgtcgggccgccggaagccccgctg
cagctggcgcgcgtcaccgtcgccggggtgggcgagccgaggcgggtccgcatcgacggg
gacggcctgaccggggaggcggtcgccgatatcggcgacgagctcgtcgaggtccccgtc
accgtggaccgtccggtggtcggcgagcgacggtccgcgcgggtgcgcgccgggcgcgcg
gacatgccgttcgagttcacggtcgccgagcccggctggaccatgttcatggtcagtcac
ttccactacgacccggtgtggtggaacacccagggcgcctacaccagcgaatggaccgag
gatccgccggggcgggcccggcagaccaacggcttcgagctcgtgcacgcccacctggag
atggcccgccgcgagcccgagtacaagttcgtgctcgccgaggtggactacctcaagccg
tactgggacacccgccccgaggaccgcgccgacctgcgccggttcatcgcgcagggccgc
gtcgaggtgctgggcggcacctacaacgaaccgaacaccaatctcaccagcccggaaacg
accatccgaaacctggtgcacggcatgggttttcagcgccacgtcctgggtgccgacccg
gcgaccgcgtggcagctggacgtgttcggccacgacccgcagttcccgggcctggccgcc
gacgccggcctgacgtcgagttcgtgggcccggggaccgcaccaccagtggggcccgatg
cacagcgacggcggactgggcggcatgcagttctgcagcgagttcgagtggatctcgccg
tcgggccgcggcctgctcacccactacatgcccgcgcattactcggcggggtggtggatg
gactccgcgaccacgctgcgcgaggcctccgacgccacgtacgagctgttcgatcagctc
aaaacggtggcgctgacccgcaacgtgctgctgcccgtcggcaccgactacacgccgccc
aacacatgggtcaccgcgatccatcgcgactgggccgcccgctacacctggccgcgattc
gtatgcgcgctgccgcgcgagttcttcgcggcggtgcgcgccgagctggcgcagcgcggg
tgtgagccgtcgccgcagacccgggacatgaacccgatctacaccggcaaggacgtgtcc
tacatcgacaccaaacaagccaaccgggccgcggagaacgccgtgctggcggccgagcgg
ttcgcggtgttcgcggccctggcgaccggcgccgactacccgcatgcggccctggccaag
gcgtgggtgcagctggcctacggcgcgcaccacgacgcgatcaccgggtcggaatccgac
caggtctacctcgacctgttgaccggctggcgcgacgcgtgggagctgggccgcgcggcc
cgggacgcctcgctggcgctgctgtccggggcgatcgagggcgacgtcgtcgtgtggaat
cccctggcgcacccacgcaccgacctcgtcaccgcgcgcatcgatccgccgctgcccgcg
ggcgtgcaggtgctggacgccgacggcgccgaactgcccgcgctggtgcagcacgacggg
agctcggtcacctggctggcccgcgatgtcgggtcgctgggctggcgggcctaccggctg
gcacccgccgaccaagcggccggctgggcggcggtgccgggatcggtgatcgccaacgag
cactaccggctcgaggtcgacgcggcccgcggcggggccgtcgcctcgctgatcgacttg
tctgcccaggggggccgcgagctgatcgccgagggccgggtgggcaacgagctcgccgtc
tacgaggaatacccgtcgcaccccacgcagggcgagggaccgtggcacctgctgcccaag
gggccggtggtgtgctcgtcggaatcgccggcgcgggtgcgggccttccgcggacccctc
ggtgagcgggtggtggtccgcggccggataggcacgctgctgcgctacacccagaccctg
acgctgtggcggggcgtcgcgcgggtggactgccgcaccaccatcgacgacttcaccggc
gccgatcagctggtgcggctgcgctggccgtgcccggtgccgggcgccatgccggtcagc
gaagtcggcgacgccgtcgtcggccgcggtttcgcgctgctgcacgacgggccgcgcgcg
gtggacaccgcccggcacctgtgggccctggacaacccggcgtacggctggttcggcctg
tcctcggccgcccgggtccgggtgtcgggggccggggtgcgggcgatctcggtcgccgag
gtggtgtctccggcggaggcggtgtccgggccgctggcgcgcgagctgatggtggcgctg
gtccgcgccggagtcacggccacctgcaccgccgcggacaagccccgctacggccacctg
gaggtggattccaacctgcccgacgtgcggatcgcgctgggcgggccggaccgcaacgcc
ttcaccgaggcggtgctggcccacgccgatccggtgtacgccggggaactcgaccgccag
ctggcggcgaccggccgggcccgggtgtgggtgccggccgagacgccgctggccgcggtg
tgggtgcccggcgccgacctgcgtggactgcgggcgctgccggtgctggtcgtcgacggc
cgcgccgacgaggacctgcgcgcggagatcgccgcgctggccgacgatctcggtgacgcc
gagatcgtcgtcgcgcagcggcccgcgtcgggaacggaggcgttcgaggaccgcaccgtc
gccctgctcaaccgcggggtgcccagcttcgccgtcgacaccgagggcaccctgcacacc
gcgctgatgcgctcgtgcaccggctggccgtcgggcatctggatcgatgacccccgccgc
accgcgccggacggctccaacttccagctgcagcactggacccacgatttcgactacgcg
ttggtcagcggcgacggcgactggcggcgcgccgacattcccacccgcagcgcgcagttc
gcgcagccgctgctcgccgtcgccggcggccggcggcccggtgcgctgccgccggccggt
gcgctgctgcgcgtcgagcccgccgactcggtccacctggcggccctcaaggcggccggc
gatccgctgaccgcgggccgcgccgcgccggtcgacccgcactcggtcgccctgcggttg
gtggagacgaccggggcgggcgcgcgggtgacgcttagctcggacgtcgcggcgatcagc
gacctgcgggccgccgacctcctggaggcccccgaggggcggctggattcggtcgacctg
cacggctaccaggtggcgaccgtgctggcccggttcgacctgcccgcgacgctctcggac
gccgccgccctggcgccgaacgccgaggccgcccagccgctctacgcccgctattggctg
cacaatcgcgggcccgcgccgctcggcggcctgcccgcggtcgcccacctgcacccgtcg
cagatcagcgcgcagcccggccgcgacgtgacggtgcgtctgaccgcggccagcgactgc
agcgacgccacgctgcgcggcggggtcgtcctcgcgtgcccggacggctggtcggccacg
cccgccgagctgcccttcaccctgtgcagcggcggccacctggaggccgacgtggtggtg
tcgatcccgccgacggcagaaccgggcctctaccccgtccgggcacggctgcgcctcacc
ggcgaacacatccccgccccctggcggcaagcggtcgaggacgtgtgcgtggtcgcggtg
ggcggcgcggcggtcgacccgggcggcctggtctacctcgccgacgggccgcgcgaggtc
acgctgcgacccggcgaagcgggtgaggtgaccgtcaccgtcggcacccacgcccgggcc
gatttggcgctcgaggcgcatctgatcagcccctggggcacgtgggaatggatgggaccc
gccgccctcggcgcggtcctgcccgccggcggcaccgtcggcctcggcttccgggtgacc
ccgccggcctggctgggacccgggcaatggtgggcgctggtgcgcatcggctgcgccggg
cggctggtctactcgcccgcggtccgggtgacggtgacatga

DBGET integrated database retrieval system