KEGG   Mycobacterium intracellulare ATCC 13950: OCU_43930Help
Entry
OCU_43930         CDS       T02158                                 

Definition
(GenBank) transcription antitermination protein NusG
  KO
K02601  
transcriptional antiterminator NusG
Organism
mia  Mycobacterium intracellulare ATCC 13950
Brite
Transcription machinery [BR:mia03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     OCU_43930
Ribosome biogenesis [BR:mia03009]
 Prokaryotic Type
  rRNA transcription factors
   OCU_43930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4619564..4620367)
Genome map
AA seq 267 aa AA seqDB search
MTSFDGDPSAGDAVDLKETTEAAEVSDDTATSEVSEATTDEATTDEAADAAGAPDEPAEE
VDPAVALKAELRSKPGDWYVIHSYAGYENKVKANLETRVQNLDVGDYIFQVEVPTEEVTE
IKNGQRKQVNRKVLPGYILVRMDLTDDSWAAVRNTPGVTGFVGATSRPSALTLDDVVKFL
LPRGATKKAAKGAATTATAAEAGGLERPAIEVDYEVGESVTVMDGPFATLPATISEVNGE
QQKLKVLVSIFGRETPVELTFSQVSKL
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtgactagcttcgacggtgacccgtccgcgggtgacgcggtcgacctgaaagagaccacg
gaagctgccgaggtttctgacgacacggcgacctccgaggtttccgaggcgaccacggac
gaggcgaccacggacgaggccgccgacgctgccggggcgcccgacgagccggccgaagag
gtcgacccggccgtcgcgctcaaggcggaactgcgcagcaagcccggcgactggtacgtc
atccactcctacgcgggatacgagaacaaggtcaaagccaacctcgaaacgcgggtgcag
aacctcgacgtcggcgactacatcttccaggtcgaggtgcccaccgaagaggtcaccgag
atcaagaacggccagcgcaagcaggtcaatcgcaaggtgctgcccggctacatcctggtg
cgcatggacctgacggacgactcgtgggccgcggtgcgcaacacccccggcgtcaccggg
ttcgtcggggcgacctcgcgcccgtcggccctgacgctcgacgacgtggtgaagttcctg
ctgccgcgcggcgcgacgaagaaggccgccaagggggcggctacaaccgccaccgccgcc
gaggccggggggctggaacgcccggccatcgaggtcgactacgaggtcggcgaatcggtc
acggtcatggacggcccgttcgcgacgctgccggccacgatcagcgaggtcaacggcgag
cagcagaaactcaaggtgctggtgtcgatcttcggccgcgaaaccccggtcgaattgacc
ttcagccaagtctccaagctctaa

DBGET integrated database retrieval system