KEGG   Mycobacterium intracellulare ATCC 13950: OCU_44120Help
Entry
OCU_44120         CDS       T02158                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mia03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4639352..4641073
Genome map
AA seq 573 aa AA seqDB search
MTAEVMFATGLLRTFTDAGVFEAADVHVAQRLTALTGESDERVALAVALVVRALRGGSVC
VDLRAAPGLLGDADLPWPGADDWLAAVRASALLGPPPVLRFFGDLLYFDRYWLEEEQVCT
DLLALSAPPVGIESSSYERLFEPGYEEQRAAAEIAVSHAVTVLTGGPGTGKTTTIARLLA
LLLEHAERAGMPPPRIALAAPTGKAAARLAEAVAAGARRLGAADRARLAGLSGTTLHRLL
GPRPDTSVRFKHNRANRLPHDVIVVDETSMVSLTMMARLAEAVRPDSRLILVGDPDQLAS
VEAGAVLADLVDGLSARGDVRVAALRTPHRYGTSIGALAEAIRVGDADRVVELLAAGGEH
VEWVDAQRPADRLREVLVAHALRLRSAALLGAADEALATLDEHRLLCAHREGPYGATHWN
TLVQKWIAEATGQPAWSQWYAGRPLLVTANDYGLRLYNGDTGVAVAGAEGLRAVIAGASG
PLDFATSRLGEVETMHAMTIHKSQGSQADEVTVLIPPEDSRLLTRELFYTAVTRAQTRVR
VVGPEASVRAAIERRAMRATGLRQRLRADAAAT
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgacggcggaggtgatgttcgcgaccggattgctgcgcacgttcaccgatgccggcgtc
ttcgaggcggcggacgtgcatgtggcgcaacggcttaccgcgctcaccggcgagtccgac
gaacgggtggccctagcggtcgcgctggtggtacgcgcgctgcggggcggttcggtctgc
gtcgatctccgcgcggcgcccgggctgctcggcgacgccgacctgccgtggcccggcgcc
gacgactggctggcggcggtgcgggccagcgcgttgctcgggccgcctccggtgctgcgg
tttttcggcgatctgctgtacttcgaccggtactggctcgaggaggagcaggtgtgcacc
gacctgctggccttgtcggcgccgccggtcggcatcgaatcgtccagttacgaacggctt
ttcgagcccgggtacgaggagcagcgggccgccgccgaaatcgcggtgtcgcacgcggtg
accgtgctgaccggtggccccggcaccggcaagaccaccacgatcgcgcggctgctcgcc
ctgctcctcgagcatgccgagcgggccgggatgccgccgccgcggatcgcgctggccgca
ccgaccggcaaggcggcggcgcggctggccgaggcggtggccgcgggggcccgacggctc
ggcgcggccgaccgggcgcggctggccggcctgtccgggaccacgctgcaccggctgctg
ggtccccggccggatacgtcggtgcggttcaagcacaatcgcgccaaccggctgccgcac
gacgtcatcgtggtggacgagacgtcgatggtgtcgttgacgatgatggcccggctggcc
gaagcggtccgcccggactcccggttgattctggtcggcgacccggaccagttggcctcg
gtggaggcgggcgccgtgctggccgacctggtggacgggctgtccgcccgcggcgacgtg
cgggtggccgccctgcgcacgccgcaccgatacggcacgtcgatcggcgcgctggccgag
gcgattcgggtcggcgacgcggaccgggtggtggagctgctggcggccgggggcgagcac
gtcgagtgggtggatgcacagcgcccggccgatcggctgcgcgaggtgctcgtcgcgcac
gcgctgcggctgcggtcggccgcgctcctgggcgcggccgacgaggcgctggccacgctg
gacgaacaccggctgctgtgcgcgcaccgcgagggcccgtatggggcgacacactggaac
acgttggtgcagaagtggattgccgaggcgacggggcagccggcatggtcgcagtggtac
gccgggcgcccgctgctggtgaccgccaacgactacggcctgcggctctacaacggcgac
accggtgtggcggtggccggcgcggagggcctgcgggcggtcatcgccggtgccagcggg
ccgctagacttcgcgaccagccgtctcggcgaggtggagacgatgcacgccatgaccatc
cacaagagtcagggcagccaggccgacgaggtgaccgtgctgataccgccggaggattcg
cgactgctgacgcgggaactgttctacacggccgtgacccgggcgcagaccagggtgcgg
gtggtggggcccgaggcctcggtgcgcgcggcgatcgagcgccgggcgatgcgggccacc
ggattgcggcaacggctgcgggccgacgccgccgcgacgtga

DBGET integrated database retrieval system