KEGG   Mycobacterium intracellulare ATCC 13950: OCU_45020Help
Entry
OCU_45020         CDS       T02158                                 

Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
mia00860  Porphyrin and chlorophyll metabolism
mia01100  Metabolic pathways
mia01110  Biosynthesis of secondary metabolites
mia01120  Microbial metabolism in diverse environments
Module
mia_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mia00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    OCU_45020
Enzymes [BR:mia01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     OCU_45020
Exosome [BR:mia04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OCU_45020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD OMPdecase
Motif
Other DBs
NCBI-ProteinID: AFC45721
UniProt: H8ITG7
Position
complement(4737577..4738500)
Genome map
AA seq 307 aa AA seqDB search
MVAQTSLEPRHLVLPMFVADGIDEPRPIASMPGVVQHTRDSLRAAAASAVAAGVGGLMLF
GVPRDEDKDAVGSAGTDPDGILNVALRDLAKDLGEATVLMADTCLDEFTDHGHCGVLDDR
GRVDNDATVARYVKLAVAQAESGAHVVGPSGMMDGQVGAIRDGLDAAGHTDVAILAYAAK
FASAFYGPFREAVSSSLSGDRRTYQQEAGNSREALREIQLDLDEGADIVMVKPAMGYLDV
VSAAASISPVPVAAYQVSGEYAMIRAAAANNWIDKRAAALESLTSIRRAGADIVLTYWAA
DAAGWLS
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
ttggtcgcgcaaacgtcgctggagccaaggcatttggtgctgccgatgttcgtcgccgac
ggcatcgacgagccccggccgatcgcctcgatgccgggggtggtccaacacacccgcgat
tcgttgcgcgccgccgccgccagcgccgtcgccgccggggtgggcgggctaatgctgttc
ggtgtgccgcgtgatgaggacaaggacgcggtggggtcggccggcaccgatcccgacggc
atcctcaacgtcgccctgcgcgacctggccaaggacctcggcgaggccaccgtgctgatg
gccgacacctgcctggacgagttcaccgaccacggccactgcggcgtcctcgacgaccgc
ggtcgggtcgacaacgacgcgaccgtagcccgatatgtgaaactcgctgtggcgcaagcg
gaatcgggcgcgcacgtggtaggtccgagtgggatgatggacggtcaggtgggcgcgatt
cgcgacgggctggacgcggccggccataccgacgtggcgatcctcgcctacgccgccaag
ttcgcatcggcgttctacggtccgttccgcgaagcggtcagttccagcctctccggcgac
cggcgcacctatcagcaggaggcgggcaattcccgcgaggcgctccgcgagatccagctc
gatctggacgagggcgccgacattgtgatggtgaagccggcgatgggttatctggacgtg
gtgtcggcggcggcctcgatttcgccggtgccggtggccgcctatcaggtgtcgggggag
tacgcgatgattcgcgctgcggccgcgaacaattggatcgacaagcgcgcggcggccctg
gaatcattgacgagcatccggcgggccggagccgatatcgttctcacctattgggccgcg
gacgcggcagggtggctttcgtga

DBGET integrated database retrieval system