KEGG   Mycobacterium intracellulare ATCC 13950: OCU_45260Help
Entry
OCU_45260         CDS       T02158                                 

Definition
(RefSeq) phosphoglyceromutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mia00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OCU_45260
   01230 Biosynthesis of amino acids
    OCU_45260
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OCU_45260
  Energy metabolism
   00680 Methane metabolism
    OCU_45260
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    OCU_45260
Enzymes [BR:mia01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     OCU_45260
Exosome [BR:mia04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   OCU_45260
  Exosomal proteins of melanoma cells
   OCU_45260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4760730..4761479)
Genome map
AA seq 249 aa AA seqDB search
MGDSATLILLRHGESEWNSLNLFTGWVDVGLTDKGRTEAVRSGELLAEHNLLPDVLYTSL
LRRAISTAHLALDAADRLWIPVRRTWRLNERHYGALQGLDKAETKARYGDDQFMAWRRSY
DTPPPPIEKGSTYSQDTDPRYADIGGGPLTECLADVVVRFLPYFTDVIVPDLRSGKTVLI
VAHGNSLRALVKHLDRMSDDDIVGLNIPTGIPLRYDLDADLRPVVPGGTYLDPEAAAAGA
AAVAGQGRG
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgggtgactccgccacgctgatcctgctccgccacggtgaaagcgaatggaattcgctg
aacctgttcaccggttgggtggacgtcgggctgaccgacaagggccgcaccgaggcggtg
cgcagcggcgagctgctggccgaacacaatctgttgcccgacgtcctctacacgtcgctg
ctgcgccgggccatctccaccgcgcacctggcgctggacgccgccgaccggctgtggatc
ccggtgcggcgcacctggcggctcaacgaacgccattacggggcgctgcagggcctggac
aaggccgagaccaaggcgcgctacggcgacgaccagttcatggcctggcgacgcagctac
gacacgccgcccccgccgatcgagaagggcagcacctacagccaggacaccgatccccgc
tacgctgacatcggcggcgggccgctgaccgagtgcctcgccgacgtggtcgtccgtttc
ctgccgtatttcaccgacgtcatcgtcccggacctgcgcagcggcaagacggtgctgatc
gtcgcgcacggcaactcgctgcgggccctggtcaagcacctcgatcggatgtccgacgac
gacatcgtgggcctgaacatcccgaccggcatcccgctgcgctacgacctggacgccgac
ctgcgcccggtggtgcccggcggcacctatctggaccccgaggcggccgccgccggtgcc
gccgcggtcgccggccagggacgcggctga

DBGET integrated database retrieval system