KEGG   Mycobacterium intracellulare ATCC 13950: OCU_45260Help
Entry
OCU_45260         CDS       T02158                                 

Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
mia00010  Glycolysis / Gluconeogenesis
mia00260  Glycine, serine and threonine metabolism
mia00680  Methane metabolism
mia01100  Metabolic pathways
mia01110  Biosynthesis of secondary metabolites
mia01120  Microbial metabolism in diverse environments
mia01130  Biosynthesis of antibiotics
mia01200  Carbon metabolism
mia01230  Biosynthesis of amino acids
Module
mia_M00002  Glycolysis, core module involving three-carbon compounds
mia_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mia00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OCU_45260
  Energy metabolism
   00680 Methane metabolism
    OCU_45260
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    OCU_45260
Enzymes [BR:mia01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     OCU_45260
Membrane trafficking [BR:mia04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    OCU_45260
Exosome [BR:mia04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   OCU_45260
  Exosomal proteins of melanoma cells
   OCU_45260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AFC45745
UniProt: H8ITJ1
Position
complement(4760730..4761479)
Genome map
AA seq 249 aa AA seqDB search
MGDSATLILLRHGESEWNSLNLFTGWVDVGLTDKGRTEAVRSGELLAEHNLLPDVLYTSL
LRRAISTAHLALDAADRLWIPVRRTWRLNERHYGALQGLDKAETKARYGDDQFMAWRRSY
DTPPPPIEKGSTYSQDTDPRYADIGGGPLTECLADVVVRFLPYFTDVIVPDLRSGKTVLI
VAHGNSLRALVKHLDRMSDDDIVGLNIPTGIPLRYDLDADLRPVVPGGTYLDPEAAAAGA
AAVAGQGRG
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgggtgactccgccacgctgatcctgctccgccacggtgaaagcgaatggaattcgctg
aacctgttcaccggttgggtggacgtcgggctgaccgacaagggccgcaccgaggcggtg
cgcagcggcgagctgctggccgaacacaatctgttgcccgacgtcctctacacgtcgctg
ctgcgccgggccatctccaccgcgcacctggcgctggacgccgccgaccggctgtggatc
ccggtgcggcgcacctggcggctcaacgaacgccattacggggcgctgcagggcctggac
aaggccgagaccaaggcgcgctacggcgacgaccagttcatggcctggcgacgcagctac
gacacgccgcccccgccgatcgagaagggcagcacctacagccaggacaccgatccccgc
tacgctgacatcggcggcgggccgctgaccgagtgcctcgccgacgtggtcgtccgtttc
ctgccgtatttcaccgacgtcatcgtcccggacctgcgcagcggcaagacggtgctgatc
gtcgcgcacggcaactcgctgcgggccctggtcaagcacctcgatcggatgtccgacgac
gacatcgtgggcctgaacatcccgaccggcatcccgctgcgctacgacctggacgccgac
ctgcgcccggtggtgcccggcggcacctatctggaccccgaggcggccgccgccggtgcc
gccgcggtcgccggccagggacgcggctga

DBGET integrated database retrieval system