KEGG   Mycobacterium intracellulare ATCC 13950: OCU_45490Help
Entry
OCU_45490         CDS       T02158                                 

Definition
(RefSeq) isocitrate lyase (EC:4.1.3.1)
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mia00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OCU_45490
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    OCU_45490
Enzymes [BR:mia01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     OCU_45490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4778978..4780264)
Genome map
AA seq 428 aa AA seqDB search
MSVVGTPKSAEQIQKDWDTNPRWKDVTRTYSAKDVAALQGTVVEEATLARRGAEVLWEQL
HDLEYINALGALTGNMAVQQVRAGLKAIYLSGWQVAGDANLSGHTYPDQSLYPANSVPQV
VRRINNALLRADEIAKVEGDTSVKNWLAPIVADGEAGFGGALNVYELQKAMIAAGVAGSH
WEDQLASEKKCGHLGGKVLIPTQQHIRTLTSARLAADVCDVPTVVIARTDAEAATLITSD
VDERDQPFITGERTKEGFYRVRNGLEPCIARAKAYAPYSDLIWMETGTPDLELAAKFAEG
VKSEFPDQMLAYNCSPSFNWKKHLDDSTIAKFQKELGAMGFKFQFITLAGFHALNYSMFD
LAYGYARNQMSAYVELQEREFAAEERGYTATKHQREVGAGYFDRIATTVDPSSSTTALTG
STEEGQFH
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtcgttggcacccccaagagcgccgaacagattcagaaggactgggacaccaac
ccgcggtggaaggacgtcacccgcacctacagcgccaaggacgtcgccgccctgcagggc
accgtcgttgaggaggccaccctggcccgccgcggcgccgaggtgctgtgggagcagctc
cacgacctcgagtacatcaacgcgctcggcgcgctgaccgggaacatggccgtccagcag
gtgcgcgccggcctcaaggccatctacctgtccgggtggcaggtcgccggggacgcgaac
ctgtccgggcacacctaccccgaccagagcctctacccggccaactcggtgccccaggtg
gtccgccggatcaacaacgcgctgctgcgcgccgacgagatcgccaaggtcgagggcgac
acctcggtgaagaactggctggcccccatcgtcgccgacggtgaggccggtttcggtggc
gcgctcaacgtctacgagctgcagaaggccatgatcgcggccggtgtggcgggctcgcac
tgggaggaccagctggcttcggagaagaagtgtggtcacctgggcggcaaggtgctgatc
ccgacacagcagcacatccgcaccctgacctcggcccggctggcggccgacgtgtgcgac
gtgccgaccgtcgtcatcgcccggaccgacgccgaggcggccacgctgatcacctccgac
gtcgacgagcgcgaccagccgttcatcaccggtgagcgcaccaaggagggcttctaccgg
gtccgcaacggcctggagccctgcatcgcccgggccaaggcgtacgcgccgtactccgac
ctgatctggatggagaccggcactccggacctcgagctcgccgcgaagttcgccgagggc
gtcaagtccgagttccccgaccagatgctggcctacaactgctcgccgtcgttcaactgg
aagaagcaccttgacgactccaccatcgcgaagttccaaaaggagctcggcgcaatggga
ttcaagttccagttcatcaccctggccggcttccacgccctgaactactcgatgttcgac
ctggcctacggctacgcccgcaaccagatgagcgcctacgtcgagctgcaggagcgcgag
ttcgccgccgaggagcgtggctacaccgccaccaagcaccagcgtgaggtgggtgccggt
tacttcgaccgcatcgccaccacggtcgacccgagctcgtcgaccaccgcgctgaccggc
tccaccgaagaggggcagtttcactga

DBGET integrated database retrieval system