KEGG   Mycobacterium intracellulare ATCC 13950: OCU_48040Help
Entry
OCU_48040         CDS       T02158                                 

Definition
(GenBank) uroporphyrinogen-III synthetase/response regulator domain protein
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
mia00860  Porphyrin and chlorophyll metabolism
mia01100  Metabolic pathways
mia01110  Biosynthesis of secondary metabolites
mia01120  Microbial metabolism in diverse environments
Module
mia_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mia00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    OCU_48040
Enzymes [BR:mia01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     OCU_48040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Trans_reg_C Peripla_BP_6 TMEM213
Motif
Other DBs
NCBI-ProteinID: AFC46023
UniProt: H8IX31
Position
5035937..5037100
Genome map
AA seq 387 aa AA seqDB search
MAPQLAPPDSAPLTGYRIAVTSANRAEELCALLRRNGAEVSSAAAINLIALPEDEELHRH
TEAVIAEPPDILVAHTGIGFRGWVAAADGWGLATQLLASLSRARIVARGPKATGALRAAG
LHEEWSPRSESSSEVLRYLLESDVAGKRVAVQLHGAADTWDPFPEFLNGLRSAGAQVVPI
HVYRWKPTPAGGDFDQLVTSVARRQFDAVTFTSAPAGAALLERSRELGVEEQLLQALRSD
VHAMCVGPVTAQPLLRAGVPTSSPERMRLGALARHIAQELPTLRSTTIRAAGHEMEIRGT
CVLVDGSPRSLSGSGMATLRALAERPGDVVARNDLLRVLPGNSNDPHAVDTAVLRLRTAL
GDKNIIATVVKRGYRLAIDHPDESPWH
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggccccccaactggccccaccagactccgcgccgctgaccggctaccggatcgccgtg
acgtcggcgaaccgggccgaagagctgtgcgcgttgctgcgccgcaacggcgcggaggtg
tccagcgccgcggccatcaacctcatcgcgctgcccgaagacgaagaactgcaccgccac
accgaagcggtcatcgccgagcctcccgatatcttggtggcgcacaccggcatcggcttc
cgcggctgggtcgccgcggccgacggctggggactggccacccagctgctggcgtccctg
tcccgggcgcggatcgtggcccgcgggccgaaggcgaccggcgccttgcgcgccgccgga
ctgcacgaggagtggtcgcccaggtccgaatcgtcgagcgaggtcctgcgctacctgctc
gaatcggatgtcgccggaaagcgggtcgcggtccagctgcacggcgcggccgacacctgg
gacccgttcccggaattcctcaacgggttgcggtccgcgggcgcccaggtggtccccatc
cacgtatatcgctggaaaccaacgccggccggcggcgacttcgaccaactcgtcacctcg
gtcgcccggcggcagttcgacgcggtgaccttcacctcggcgcccgcgggcgcggcgctg
ctggagcgcagccgcgagttgggcgtcgaagagcaactgctgcaagcacttcgcagcgac
gtgcacgcgatgtgcgtgggcccggtcaccgcgcagcccctgctccgcgccggggtcccc
acgtcgtcgcccgagcgaatgcggttgggggcgttggcccgtcacatcgcccaggagctc
ccgacccttcgctcgaccaccatccgggcggccggccacgagatggagatccgcgggacc
tgcgtgctggtcgacggttcgccgcggtccctgtcgggatcgggaatggcgacgctgcgc
gcgctggcggagcgccccggcgacgtcgtcgcgcgcaacgacctgttgcgggtgcttccc
ggcaacagcaacgatccccacgccgtcgacacggccgtgctgcggctgcgaacggcgctg
ggcgacaagaacatcatcgcgacggtggtcaagcgtggctaccggctcgcgatcgaccat
ccggacgaatccccatggcactga

DBGET integrated database retrieval system