KEGG   Mycobacterium intracellulare ATCC 13950: OCU_48260Help
Entry
OCU_48260         CDS       T02158                                 

Definition
glycosyl hydrolase family protein 3 (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mia00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    OCU_48260
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    OCU_48260
Enzymes [BR:mia01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     OCU_48260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5058058..5059209)
Genome map
AA seq 383 aa AA seqDB search
MAFSRTFAVLAAASALVAGCGHHPAPPAHSSTSSKPAAAPAPPVCADPAAVPAALGIRDK
LAQLLMVGVKNADDARAVVNGYHVGGIFIGSWTDLAIFQGPLADISAKAGPLPLAVSVDE
EGGRVSRLKTLIGTSPPARELAQTQTVQQVHDLAADRGRKMRDLGITVDFAPVVDVSDED
DDAVIGNRSFGADPQTVTDYAGAYARGLRDAGLLPVLKHFPGHGHGSGDSHTGGVVTPPL
ADLQTSDLVPYRSLVAAAPVAVMVGHLQVPGLTGDVPASLSPEAVQLLRNGVGYKGPPFT
GPVFSDDLSSMAAISDRYGVSEAVLRSLLAGVDVALWVTTDEVPAVLDRLQKAVASGELP
ARRVDEALVRVAKMKGPGPTCGH
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggcattttcgcgcaccttcgccgtgctcgcggccgcgtcggcgctggtggccggctgc
ggccaccacccggcgccacccgcccactcgtcgacgtcgagcaagccggcggccgcgccc
gcgcccccggtgtgcgccgacccggcggcggtgccggccgcgctgggcatccgcgacaag
ctggcccaactcctgatggtgggcgtgaagaacgccgacgacgcccgggccgtcgtcaac
ggctaccacgtcggcgggatcttcatcggcagctggaccgacctcgcaatcttccagggg
ccgttggcggacatcagcgccaaggcgggaccgctgccgctggcggtcagcgtcgacgaa
gagggtgggcgggtgtcgcggctgaagaccctgatcgggacgtcgccgccggcccgggag
ctggcgcagacacaaaccgtccagcaggtccacgatttggccgccgaccgcggccgcaag
atgcgcgacctgggcatcaccgtcgacttcgctcccgtggtcgacgtcagcgacgaggac
gacgacgccgtcatcggcaaccgttccttcggcgcggacccgcagacggtgaccgactac
gccggggcgtacgcgcggggcctccgcgacgccgggctgctgccggtgctcaagcatttc
cccgggcacgggcacggctcgggtgattcgcacaccggcggtgtggtcacgccgccgctc
gccgacctgcagaccagtgacctggtgccctaccggtcgctggtggccgcggcgccggtc
gcggtgatggtgggccacctgcaggtcccgggcctcaccggcgatgtccccgccagcctg
agccccgaggcggtgcaattgctgcgaaacggcgtcggctacaagggtccgccgttcacc
ggcccggtgttcagcgacgacctgtccagcatggccgccatctccgaccggtacggggtg
tcggaggcggtgctgcgcagcctgttggccggcgtcgacgtcgcgctgtgggtcaccacc
gacgaggtgcccgcggtgctggaccgcttgcaaaaggccgtcgcctcaggcgaactgccg
gcacgccgggtggacgaggcgctggtgcgggtggcgaagatgaagggccccggcccgacc
tgcgggcactag

DBGET integrated database retrieval system