KEGG   Microcoleus sp. PCC 7113: Mic7113_0417Help
Entry
Mic7113_0417      CDS       T02374                                 

Definition
glutathione S-transferase
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
mic  Microcoleus sp. PCC 7113
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:mic00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(464762..465553)
Genome map
AA seq 263 aa AA seqDB search
MLELYQFELSQYSEKVRLILDYKGLAYRKIEVTPGVGQLEVFQLSGQRKLPVLKDGDTVI
SDSTAIAMYLDRKYPDRPLIPTDPKQRGLCLLIEEWADESIGVKSRKVLYGAMSQSPTFR
TSVLPNTTPDFLKTIVGAVPPEVLEMLGTGVGAGPDAVKDAKDALKQDLEALSLLLLDSP
YLVGNQPTLADFAVAGVSLLLKFPEGPYLDLPENIKGKGIPGLADSSVYETFFNWRDRLY
AAYRKPLISTGTNGSAPTSIEID
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgctggagttgtaccaatttgagctatcgcaatactctgaaaaagtacggctcatcctg
gactataaagggctagcttatcgaaaaatcgaagtgacgccaggagtagggcagctagaa
gtcttccagctatctggtcaacggaagctacccgtgcttaaagatggggatactgtaatt
agtgattctacggcgatcgccatgtatttggatcgcaagtatcccgacagaccgctaatt
cccaccgatcccaaacaacgggggctgtgcttgctcatcgaagagtgggcggatgagtcg
attggggttaaaagtcggaaggtactctatggggcaatgagccaaagtcccactttccgg
acatcggttttgcccaacacgacacctgactttctcaaaaccatagtcggtgccgtcccg
ccagaagtacttgagatgttgggtacaggtgttggggctggcccagatgcggtaaaagat
gctaaagatgccctaaagcaagacttggaagccctgagtctgctgcttctggatagtcct
tatctggtcggaaaccaacctaccttagctgattttgcagtcgcgggtgttagcctgttg
ctcaagtttcccgaaggtccttacctggatttgcctgaaaacattaaaggtaagggaatt
cctggtttagccgatagtagcgtgtacgaaaccttctttaactggcgcgaccgcctttat
gccgcttatcgcaagcctctgatttctactggaacaaacggttctgcaccgacatccatc
gagattgattag

DBGET integrated database retrieval system