KEGG   Microcoleus sp. PCC 7113: Mic7113_0441Help
Entry
Mic7113_0441      CDS       T02374                                 

Definition
chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
mic  Microcoleus sp. PCC 7113
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:mic02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:mic02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
498928..499542
Genome map
AA seq 204 aa AA seqDB search
MKDCPYKIVVVGTSLGGLQALQILLPSLPKSFPLPVAIVQHRHRDSKDSLSVFLQDYCAL
PITEAEDKEAIAPGRVYLAPPDYHLLIEEGHFALSTEGAVCHARPSIDVLFESAADAYAE
GVIGVILTGASHDGSQGLLKIQEQGGLAIIEEPTTAQSPTMPKAALAALQQQQRVSNTVV
TAYWIFPLREIAPFLVNLCHLALR
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaaggattgtccatataaaattgttgtagtgggtacatcattaggggggttacaggct
ctccagattttgcttcccagtctgcccaaaagcttccccttgcccgtggcgattgtccaa
catcgtcaccgagactccaaggatagcttaagcgtcttcttacaggactattgcgctttg
ccgattactgaagcagaagacaaagaagcgatcgcaccaggacgagtctacttagccccc
cctgactatcacttgctcatcgaagagggtcactttgccctctcgacagaaggtgccgtt
tgtcatgcacgaccttccattgatgtattgtttgaatcagccgctgatgcttacgcagag
ggagtgattggggtaattttgaccggcgcgagtcatgatggaagtcaggggctgctcaaa
atccaagaacaaggcggtttggcaatcattgaggaaccgacaacggctcaaagcccaacc
atgccaaaagccgcgctcgccgctttacagcagcagcagcgtgtctccaacacggttgtg
acagcgtattggattttccctctccgtgaaattgctccttttctcgtcaacctttgccac
ttggcgctgaggtag

DBGET integrated database retrieval system