KEGG   Microcoleus sp. PCC 7113: Mic7113_0652Help
Entry
Mic7113_0652      CDS       T02374                                 

Definition
bile acid beta-glucosidase
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
mic  Microcoleus sp. PCC 7113
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mic00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Mic7113_0652
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Mic7113_0652
Enzymes [BR:mic01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Mic7113_0652
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
749519..751978
Genome map
AA seq 819 aa AA seqDB search
MIYQPPRPKIPECTWQRPIGLGWDKPYTVRYASNLDDGPWHGMPLGGFGAGCIGRSPRGD
FNLWHLDGGEHSFKSLPACQFSVFEQSENAPKQAYALCTEPPQDGTLGTWQWYPTSQQAK
GNTGTYQALYPQSWFTYENVFQTELTCEQFSPIWAGCYQETSYPVAVFEWTAHNPTDAPI
TLSIMLTWQNIVGWFTNAIKSPQVKVRDDGSPVYEYQPRWGESTGSYNQWIVDNFRVGCI
LDRVRLHDSEAVADFRGASEIQEGEGQLCFATVTNPSMEVFYHTRWNPAGNGAEVWQSFA
ADGSLSDMQDETAAAPGEQIAAAIAIRFTIRPGRTRKIPFILAWDFPVTEFSPGVNYYRR
YTDFFGRTGNNAWSIVRTALKHADLWKEKIQSWQEPILKREDLPHWFKMALFNELYLLAD
GGTLWTAADDRDPIGQFGVLECLDYRWYESLDVRLYGSFALAMLWPRLDKAVLEAFARAI
PIGDKTPRIIGYNQAQAIRKAADATPHDLGAPNEHPWEQTNYTSYQDCNQWKDLPCDFVL
QVYRDFVFTGANDTEFLWECWSSVVKTLAYLKTFDKDGDGIPENSGAPDQTFDDWRLQGI
SAYCGGLWLAALEAAIAMGEILINHYPPTSELIEVPDPESIQETLKLYRQWLEQSQPIYQ
EKLWNGQYYRLDSESGSDIVMTDQLCGQFYAQLLGLPDIVPPECVQSALKSVYDSCFLKF
QDAQLGAANGVRPDGSPENPDATHPLEVWTGINFGLAAFLVQQGMKQEALQLTEAVVRQV
YENGLQFRTPEAITAAGTFRASHYLRAMAIWAVYFMINQ
NT seq 2460 nt NT seq  +upstreamnt  +downstreamnt
atgatctatcaaccaccacgcccaaaaatccctgagtgtacctggcagcgtcccattgga
cttggctgggacaaaccctacactgtccgctatgcaagtaatctcgacgatggcccctgg
catggtatgccccttggggggtttggggcgggttgcatcggtcgttctccacgaggagac
tttaatttatggcacttggatgggggagagcattcttttaaaagcctcccggcttgtcag
tttagtgtcttcgagcaatccgagaacgcacccaagcaagcttatgctctgtgtaccgaa
ccgccacaggatggtactctgggcacgtggcaatggtatcccacatcgcaacaggcaaaa
ggcaatacgggtacttatcaggcgttatatcctcaaagttggtttacctatgaaaatgtt
tttcaaaccgaactgacttgtgagcagttttcacccatttgggcggggtgttaccaggaa
accagttacccggtagccgtatttgagtggacggcacacaaccctaccgatgctccaatt
accctcagcattatgctgacttggcagaatatcgtgggctggtttaccaatgcaatcaaa
agcccacaagtaaaagtgcgggatgatggtagtccggtgtatgagtaccagccgcgctgg
ggcgaaagcacgggaagttacaatcagtggattgtggataacttccgggtgggatgcatt
ttagaccgggtgaggctgcatgatagcgaagcggtagccgattttcgaggcgcatctgag
attcaggaaggggaagggcaactgtgttttgccacagtcaccaatcccagtatggaagtg
ttttaccacactcgctggaacccggcgggcaatggggctgaagtttggcaatccttcgcc
gccgatggcagtttgagtgatatgcaggatgagacagccgccgcaccgggagaacaaatt
gctgccgcaatcgccattcgctttaccatccgtcctggcagaacccgtaaaattcccttt
atcctcgcttgggatttccccgtcacagagttttccccaggagtcaattactatcgacgc
tataccgatttcttcggtcgcacaggcaacaacgcctggtcaattgtgcgtaccgccctc
aagcacgctgatttgtggaaggagaaaatacaatcttggcaggaacctatcttaaagcgt
gaggatttgccccattggtttaagatggctttgtttaatgagctgtacctgctggcggat
ggggggactctctggacggcggcggatgaccgtgacccgattggtcagtttggtgtgctt
gaatgcttagattatcgctggtatgaaagcctggatgtaaggctttatggttcctttgct
ctagcaatgctttggcctcgactggataaagctgtactagaagcctttgcccgcgccatc
cctatcggtgacaagacaccgcgaattattggttataaccaggcacaagccatccggaaa
gccgccgatgccaccccccacgacttaggtgcacccaacgagcatccgtgggaacagacg
aactatactagctaccaagattgcaatcagtggaaagatttaccctgtgattttgtcttg
caggtttatcgagattttgtcttcacgggggcgaacgatacagaatttttgtgggaatgt
tggtcgagtgtcgtcaaaacgttagcttacctcaagacctttgacaaagacggagatggg
attccggaaaactctggcgcacccgatcaaacctttgatgactggcggttgcaaggtatc
agcgcctactgtggtgggttgtggttggctgctttagaagccgcgatcgctatgggtgaa
atcctgatcaaccactatcctcccacatccgaactcatcgaagtccctgacccagaatcc
attcaagaaacccttaaactctatcgtcaatggttggaacaatcccaacccatttatcaa
gaaaaactctggaatggtcaatactatcgcctggatagtgagagtggttcagatatcgtg
atgacagaccaactatgcggtcaattttacgctcagttattaggtttgccggatattgtc
cctccagaatgcgtccagtctgccctcaaaagcgtgtatgattcctgtttcttaaagttt
caggatgcccaactaggagcagccaatggagtaagacccgatggttcacccgaaaatccc
gatgcaactcatcctttagaagtttggacaggcattaactttggactggcagcattttta
gtgcagcaaggaatgaagcaagaagctttgcaacttacggaagcggtcgtgcgtcaagtc
tatgagaatggactgcaatttagaacgccggaagcgattacagcagcgggaactttccgc
gctagtcattatctgcgagcgatggctatttgggcggtttatttcatgatcaatcagtag

DBGET integrated database retrieval system