KEGG   Microcoleus sp. PCC 7113: Mic7113_0899Help
Entry
Mic7113_0899      CDS       T02374                                 

Definition
beta-1,4-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
mic  Microcoleus sp. PCC 7113
Brite
Enzymes [BR:mic01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Mic7113_0899
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1033276..1034364)
Genome map
AA seq 362 aa AA seqDB search
MKYRLLIALIVFVWVPFLMLFRGSAAPSVATPSAAPTAETSEPSLRSLAQKRGIGIGTSV
NLGPFMNDPNYREVLAREFEILVPENAWKFEFVHPTPDRYEFGQVDTLINFAKDNNMEVR
GHPLVWHYSLPKWINEGNFSRDELIKILETHVKTLVGRYRGQIPTWDVVNEAINRDGSLR
DTIWLRNIGPEYIDMAFQWAHEADPQAKLFYGEYMTEEINQKSDGVYTLVSGMLQRGVPI
DGVGFQSHLGLSYLPKLDSLAQNFDRFNQLGLAVQFTELDMKIQDGKGSLEERLAKQAKA
YSDLLRVCLQAKKCTALITWGFTDRYTWIADVTGEVEAPLIFDASYRPKPAYDALKEVLS
SK
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaagtaccgtctattaattgctttaattgtttttgtctgggtgccctttttgatgtta
tttaggggcagtgccgcaccatcagtagcaaccccttcagccgcacccaccgcagaaaca
tccgagccttcgctgcgttccctggctcaaaagcgaggaataggcattggtacctcagtc
aacttgggtcccttcatgaacgatcccaactaccgagaggttctagcacgcgagtttgaa
atcttagtacccgaaaatgcttggaaatttgagtttgtgcatccaacgcctgatcgctac
gaatttggtcaagtcgatacattaatcaactttgccaaagacaataatatggaagtgcgc
ggtcatcctttggtctggcactattcattacctaaatggattaatgaaggcaacttcagc
cgagacgaattgatcaaaattttagaaacccacgtcaaaacattagtcggtcgttatcga
ggtcaaattcctacttgggatgtcgtgaatgaagccatcaatcgagatggctctttgcgt
gatacgatttggctgcgaaatattggccctgaatatattgatatggcttttcagtgggcg
catgaagctgacccacaagccaagttattttatggggagtacatgacggaggagattaat
caaaagtcagatggcgtctatactttagtttcagggatgctacagcgtggtgtaccgatt
gatggggtcggtttccaatctcacttaggattaagctatttaccgaagctggactccctt
gctcaaaactttgatcgcttcaatcaactgggtttagcggtgcagttcactgaattggac
atgaaaattcaggatggtaaagggagtttagaagagcgtttggcaaaacaagcgaaagct
tatagtgatctcctcagggtgtgtttacaggctaaaaaatgtacagcactcattacttgg
ggatttacagaccgatatacttggattgctgatgtaacgggcgaggtagaggcacccctc
atttttgatgcctcttatcgccccaagccggcttacgacgcccttaaagaagttttaagt
tctaagtag

DBGET integrated database retrieval system