KEGG   Microcoleus sp. PCC 7113: Mic7113_1337Help
Entry
Mic7113_1337      CDS       T02374                                 

Definition
alcohol dehydrogenase (EC:1.2.1.10 1.1.1.1)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
mic  Microcoleus sp. PCC 7113
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mic00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Mic7113_1337
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mic7113_1337
   00620 Pyruvate metabolism
    Mic7113_1337
   00650 Butanoate metabolism
    Mic7113_1337
  Lipid metabolism
   00071 Fatty acid degradation
    Mic7113_1337
  Amino acid metabolism
   00350 Tyrosine metabolism
    Mic7113_1337
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mic7113_1337
   00626 Naphthalene degradation
    Mic7113_1337
Enzymes [BR:mic01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Mic7113_1337
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Mic7113_1337
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1528755..1531454
Genome map
AA seq 899 aa AA seqDB search
MQTQISVTNIQELEDLIQRVKVAQEKYATYTQEQVDQIFKKAALAANAARIPLAKLAATE
TGMGIIEDKVIKNHFASEIIYNKYKQEKTCGVIEEDQSFGFQKIAEPVGILAGIVPTTNP
TSTAIFKALLALKTRNGIIFSPHPRAKQSTSEAAKIVLKAAVEAGAPEDIIGWIDEPTVP
LSQALMQHHDIKLILATGGPAMVKAAYSSGHPSLGVGAGNTPAVIDETAHIKMAVSSILL
SKTFDNGMICASEQSVIVVDEVYDTVREEFIERGAYLLTPEEREKLGRKIIVDGRLNAEI
VGQPVERLAELAEISIPANTRVLIGEVEDINTNEPFAYEKLSPILAMYRAPNFQEAVDKA
KKLVEFGGMGHTAVLYTAPSNKEHINYYESQVETARVLINTPASQGAIGDLYNFRLDPSL
TLGCGTWGGNSISGNVGPQHLLNVKTVSERRENMLWFRIPPKVYFKYGCLPTALRELVGK
KRAFIITDKPLYELGVTRPVEEILDDIGLKYDTFYDVEPDPSLGTVKKGLSLMNTFNPDV
IISIGGGSPMDAAKVMWLMYEHPEIEFEGLAMRFMDIRKRVYELPALGEKAMMVAIPTTS
GTGSEVTPFAVVTDERTGIKYPLADYALTPNMAIIDPELVMNMPKKLTAYGGIDALTHAL
EAYVSVFASEFTNGQALEAIRLLFKYLPSAYQNGAKDPKAREKVHYGATMAGMAFANAFL
GVCHSMAHKLGSTFHVPHGLANALMISHVIRYNATDIPFKQAIFPQYKYPNAKWRYARIA
DYLNLGGNTEEEKVEKLVDAIEELKRQLDIPLTIKEVLSDDDKAFYEGVEEMADQAFDDQ
CTGANPRYPLIRDLKELYTLAYRGCPIGAGLYHPEVNPSNATVVTATGGDVEESIAATV
NT seq 2700 nt NT seq  +upstreamnt  +downstreamnt
atgcaaactcaaataagcgtcaccaacatccaagaactagaagacctgattcaacgggta
aaagtggctcaagagaaatatgccacttacacccaagaacaggtagaccaaatcttcaag
aaagcggcgctagcagcaaacgcagcaagaatcccgctggctaagctggctgctaccgaa
acgggtatgggaattatcgaagataaggtgattaagaaccactttgcttcggaaattatt
tacaacaagtacaagcaagaaaaaacctgcggtgttatcgaagaagaccaatcctttggg
ttccaaaaaattgctgaacccgtagggattctggctggaattgtccccacaacgaaccca
acttccacagccatttttaaagccctgctggctctcaaaactcggaatggaattatcttc
tctcctcaccccagagcaaagcaatccaccagtgaagcggcgaaaattgttttaaaagca
gcagtggaagccggcgcaccggaagacattatcggttggattgatgaaccaacggtgcca
ttatctcaagcgctgatgcagcatcatgacatcaagctgattctcgctaccggtggccct
gcaatggtcaaagccgcctattcttcaggtcacccttctttgggagtcggtgccgggaat
actccagcggttattgatgaaacggctcatattaaaatggcagtctcatcaattttgctg
agtaaaacctttgataatggcatgatttgtgccagcgaacaatcggtgattgttgtcgat
gaggtttatgataccgtcagggaagaatttattgagcgcggtgcttacttgctaacacca
gaagagagggaaaagctggggcgtaagattattgtcgatgggcgtttgaatgctgaaatt
gtaggccaacccgtagaaaggttagcggaattagcagagatttccatacccgccaatacc
agagtcctgattggtgaagttgaagacatcaacaccaacgaacccttcgcttacgagaaa
ttgtctcccatcctggcaatgtatcgtgcacctaactttcaggaagcggtagataaagca
aagaagttggttgagtttggggggatgggtcataccgccgtactctacaccgcaccctcc
aacaaagaacacatcaactattatgaatcccaggtagaaacggcacgagtcctgattaat
acgcccgcatctcaaggggcgattggtgacctttataacttccggcttgacccctcttta
acgttaggttgtgggacttggggtggcaactcaattagtggtaatgttggcccgcaacac
ctgctgaatgttaagacggtatcggaacggcgggagaatatgctctggtttcggattccg
ccgaaggtgtactttaagtatggctgtttgcccaccgccttacgcgagttagttgggaag
aaacgggcatttatcattacggataaacccttatatgagttgggagtcacccgtccggtt
gaagagattttggatgatatcgggctgaaatacgataccttctatgatgttgaacctgac
ccatccttaggaacagttaagaagggattgagtttgatgaataccttcaatcctgatgtg
attatctcaattggtggcggttcaccaatggatgccgcgaaggtgatgtggctgatgtac
gagcatccagagatagaatttgaagggttggcgatgcggtttatggatatccgcaagcgg
gtttatgaactgccggcgctgggtgagaaagcgatgatggtggcaattccgacgacatcg
ggaacgggttcggaagtgacgccgtttgctgtggttaccgatgaacgcacggggattaag
tacccactcgctgattatgccctaactccaaatatggcgatcatagacccggagttggtg
atgaatatgccgaagaaactcacggcttacgggggtattgatgccttaactcacgcgctg
gaagcttatgtttcggtgtttgcttcagagtttaccaacggacaagcattagaggccatt
cggttactatttaagtatctgccgagtgcttaccaaaacggggcaaaagacccgaaggca
cgggagaaggtacattacggtgcaacgatggcggggatggcatttgctaatgctttcctg
ggtgtttgtcactcaatggcgcacaaattgggttctactttccatgtcccccacggttta
gcgaatgcgctgatgatttcccatgtcatccgctacaacgcgacggatataccatttaag
caagcgattttcccacaatataagtatccgaatgccaaatggcgctatgctcggattgcc
gattacctgaatttagggggtaatacggaagaagagaaggtggagaaactcgtggatgcg
atcgaagaactcaagcgtcagttagatattccgctgacgattaaggaagttctttcagac
gatgataaagccttctacgaaggagtggaagagatggcagaccaagcattcgatgaccaa
tgcactggcgcgaatccacgctatccactgattcgggatttgaaggaattgtacacctta
gcttaccggggttgtccaatcggggcaggactgtatcatcccgaagttaatccatccaat
gctactgttgtcacggctactggtggtgatgttgaggaatcgatagcggcaacagtttag

DBGET integrated database retrieval system