KEGG   Microcoleus sp. PCC 7113: Mic7113_1366Help
Entry
Mic7113_1366      CDS       T02374                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mic  Microcoleus sp. PCC 7113
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mic00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Mic7113_1366
Enzymes [BR:mic01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Mic7113_1366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1562129..1562761)
Genome map
AA seq 210 aa AA seqDB search
MISYLKGTVATIQKSSGNRVTLILDVNQIGYELQIPKRLSQELLAGSEGMVQVFTHLQIR
EDQQILYGFASAAERDLFRQLISVSGIGAQLGIALIDTLGLPNLVQAIVTGNIRALAKTP
GVGNKTAERIALELKTKLAEWRQLAGVATPASATGPSSAILEDVEMTLLALGYENSEIGQ
ALEAISQDTLVAKSRNAEEWIRSAIAWLSQ
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgatcagctatctcaaggggactgtcgcaacgattcagaaaagcagtggcaatcgcgtc
acgctgattttggacgtgaaccaaatcggctatgaattgcaaattcccaagcgtctgtca
caggaactgctagcggggtcagaagggatggtgcaagtttttacccatttgcaaattcgg
gaagaccaacaaatcctgtatgggtttgcctcggcagcggaacgagatttgtttcgtcag
ttgattagtgtgagtggaattggggcacaacttgggatcgcactgattgatactctggga
ctacctaatttagtgcaagcgatcgtgacaggcaatatccgcgccttagccaaaactccc
ggtgtaggaaacaaaacggctgaacgcattgctttagaactgaaaaccaagcttgccgaa
tggcgtcagctagcgggagtcgctacacctgcttctgcaactgggccatcctcagccatt
ctagaggatgtggagatgaccctactggctttgggttatgaaaacagcgaaattggtcaa
gcgctagaggcaattagccaggatacccttgtggcgaaaagcaggaatgcggaagagtgg
attagaagtgcgatcgcgtggttgagtcagtaa

DBGET integrated database retrieval system