KEGG   Microcoleus sp. PCC 7113: Mic7113_1388Help
Entry
Mic7113_1388      CDS       T02374                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mic  Microcoleus sp. PCC 7113
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:mic00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mic7113_1388
Enzymes [BR:mic01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Mic7113_1388
Exosome [BR:mic04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mic7113_1388
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1588670..1590322
Genome map
AA seq 550 aa AA seqDB search
MASSIEFSLFAPYNKGASLVGSFSNWEEIPMKKDKEGYFRIMVDLEDGVYQYKFRVQSKS
WFFEPDQWVDVNDPYATDIDDSTQNANVRIKDGERIVDTYVWKHDDKPLPADHELVIYEL
HVGDFSGGEDDPYARGKYKHVVEKLDYLADLGINAIELMPVKEYPGDHSWGYNPRYFFAT
ESSYGTSNELKNLIDECHARGIRVIMDGIYNHSESESPLTQIDHDYWYHHSPRDPDNNWG
PEFNYEFYDENLETYPARKFMGDQVNFWVKEYHIDGIRFDAARQIANYDFMHWIVQEAKK
AAGMKPFYTVAEHIPETTSITNADGPMDGCWHDSFYHCVLEHICGDTFDLERLKDVIDCK
RQGFMGATNVVNYLTNHDHNHVLAELGDRGILDEEAFKRRRLGAVLTMTAVGVPLLWMGE
EFGEYKYKTQEQAKIDWTLLGHDLNRNLFEFCKGLIHLRKNNHALYTENIEFIHENPEAK
VLAYSRWNDEGSRVVVVANFSDDFLAGYTIPNFPENGTWHEWTADYDVEAGDNQIMVDLG
GYEAKVFVWQ
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atggctagttcaatcgaattttccttattcgctccttataacaaaggagcatctttagtc
gggtctttttccaactgggaagaaattcccatgaagaaagataaagagggttatttccgg
ataatggttgatcttgaggatggagtttatcagtataaatttcgtgtacaatccaaatca
tggttttttgaacccgaccaatgggtagatgtcaatgacccctacgctaccgatattgat
gactctacccaaaatgccaatgtgcggattaaagatggggaacgaattgttgatacgtat
gtttggaaacacgacgataagccattacctgccgatcatgaactagtcatctacgaactg
cacgttggcgacttctccggtggtgaggatgacccctacgccagaggtaaatacaagcat
gttgtagaaaaattagattacctagccgacttaggaattaacgcgatcgagttgatgcca
gtcaaagagtatcctggtgatcatagctggggttataacccccgatacttcttcgctaca
gaatccagctatggcacgagtaacgagttgaaaaacctgattgatgagtgtcatgctcgt
ggaattcgtgtcattatggacgggatttataaccactcagaatccgaaagtcctctaacg
cagattgaccacgattattggtatcaccactctcctcgtgacccggataataactggggg
ccagagtttaactacgaattctacgacgaaaatctagagacttacccagcacgcaagttt
atgggtgaccaagtaaatttctgggtgaaagaatatcatatcgacggcattcgtttcgac
gcagcacggcaaattgctaactatgatttcatgcattggattgtccaggaagccaaaaaa
gcggctggcatgaagcctttttacaccgtggctgagcacattcctgaaacgactagcatt
accaatgcagatgggccaatggatggctgctggcatgatagtttctatcattgtgtgttg
gaacatatctgtggggatacttttgatttagagcgtcttaaggatgtgattgattgcaag
cggcaaggttttatgggtgccactaatgtggtgaattacctgacgaatcatgaccacaat
catgttttagcagaattaggcgatcgcggcattttggatgaggaagcatttaagcggaga
cgcttaggtgcggtactcacgatgacagcggttggagtgcctttgctgtggatgggtgaa
gagtttggcgagtataagtataaaactcaagaacaagccaaaatcgattggacgttactc
ggacatgacttaaatcgtaatctgtttgagttttgtaaaggcttgattcatcttcggaaa
aataatcatgccctctatacggaaaacattgaatttattcatgaaaatccagaagctaag
gtattagcttatagccgctggaatgatgaaggttctcgtgttgttgtcgttgccaatttt
tcagatgacttcttagcgggttataccattcctaatttccctgaaaatggcacttggcac
gagtggacagcggattatgatgtggaggctggggataaccaaataatggttgatctggga
gggtacgaagcgaaagtattcgtctggcagtaa

DBGET integrated database retrieval system