KEGG   Microcoleus sp. PCC 7113: Mic7113_1467Help
Entry
Mic7113_1467      CDS       T02374                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
mic  Microcoleus sp. PCC 7113
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mic00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Mic7113_1467
DNA repair and recombination proteins [BR:mic03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Mic7113_1467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1690445..1690993
Genome map
AA seq 182 aa AA seqDB search
MPGVGPKTAQRLALHILKRSEEEVQALAQALVEAKKQVGLCQVCFHLSAEPTCEICRNAN
RDNTTICVVADSRDVIALEKTREYKGKYHVLGGVISPMDGIGPDQLHIQQLVRRVSQRGI
KEVILAISPSVEGETTTLYVGHLLKPFTKVTRIAFGLPVGGDLEYADEVTLARALEGRRE
LD
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
ttgcccggagttgggccgaaaacggctcaacggctggctttacatatcctcaagcgctca
gaggaagaagtacaggcattggctcaagccttagttgaggcgaaaaaacaagtcggctta
tgccaggtatgctttcacctctccgctgaacccacctgcgaaatctgccgcaacgccaac
cgggacaacaccactatctgtgtcgttgctgactcccgcgatgtgattgccctggaaaaa
acgcgggaatataaaggtaaatatcacgtcctcggtggcgtcatctcacccatggatgga
attggtcccgatcaattgcatattcagcaattggtgcggcgagtcagccagaggggtatc
aaagaggtgattttagccattagtccgagcgtggaaggtgagacaaccacgctctatgtt
ggtcacctcctgaagccgtttactaaggtcactcggattgcttttggtctacctgtaggc
ggcgatttagagtatgctgacgaggtcacgttagcacgagccttagaaggacgacgtgaa
ctcgattag

DBGET integrated database retrieval system