KEGG   Microcoleus sp. PCC 7113: Mic7113_1569Help
Entry
Mic7113_1569      CDS       T02374                                 

Definition
(GenBank) uroporphyrin-III C-methyltransferase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
mic  Microcoleus sp. PCC 7113
Pathway
mic00860  Porphyrin and chlorophyll metabolism
mic01100  Metabolic pathways
mic01110  Biosynthesis of secondary metabolites
mic01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mic00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mic7113_1569
Enzymes [BR:mic01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Mic7113_1569
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Mic7113_1569
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 TP_methylase
Motif
Other DBs
NCBI-ProteinID: AFZ17444
UniProt: K9WCF5
Position
1823231..1825186
Genome map
AA seq 651 aa AA seqDB search
MGKVYLVGAGPGNIEYLTIRAQQLLEQAEVLIYDALVDERLLTLVPPNCIQFDMGKRGGR
PSPSQSEINQLMVEQCRQGKQVVRLKSGDPFIFGRATSEILSLQEANCPFEVVPGISSAL
AAPLLAGIPLTDTVLSRGFAVVSAHEPEELDWEALARLETVVILMGTRHLGEIVKQLQRH
KRSPSSPIAVIRDCGRPEQQVWVGTLKDIVKQTTGISLSPAVIVIGEVVGLRDYLQSPSE
PEVPSSPEVVIGEELRVEAWDVKPLPELKVDTSPGEELPVLNLEQWNVEPSPELNDDTLP
PEESPGFNVAQWDVKPLPELKVDNPPPEESPDLTIEQLNIEISQALEVNPLPVEPSPENL
QPVNLQPVNLQLDNVQPSPLTPSLPLTGKTVLVTRSAGQSSHFSYLLQQEGAEVIEMPAL
VITPPSSWEELDHAIAQLYNFDWLILTSSNGVEYFFERLHAQGKTNRALGTVQIAVVGKK
TAASLKAHGLEPDFIPPNFVADSLVEHFPEPLEGKSILFPRVESGGRDVLVKQITAQGAE
VTEVAAYESGCPAQMAPAAKTALQQQRVDIITFASSKTVKHFVQLLETSLPEDAPGLPIA
QSRLENVCVASIGPQTSITCRQLLGRVDVEAQEYTLEGLIQAIVQWTTDRY
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaagtttacctggtaggtgcagggccgggaaatatcgaatatctcacaattcgg
gcacagcagttgctggaacaagccgaggtactcatctacgatgccttagtcgatgagcga
ttgttgacgttagtgccccccaactgcattcagttcgatatggggaaacggggtggacgc
cccagcccgtcccaatccgagattaaccaattgatggtagaacagtgtcggcaaggcaaa
caggttgtcaggctcaaaagtggcgatccgtttatttttggtcgcgctacctcggaaatc
ttatccttgcaggaagctaactgtccgtttgaggtggtgccgggaatttcctccgcccta
gcggcaccgttactcgctggaattcccctcacggataccgtattgagtcgaggctttgcg
gtggtgagtgcccatgaaccagaagagttggactgggaagcgttggcacggctggagaca
gtggtgattttgatgggtacacgtcatctgggggaaattgtcaagcaattgcaacgccat
aagcgatcgccttcttcacccatcgccgtgattcgtgattgtggacgccccgaacaacag
gtttgggtcggcactttaaaggatatcgttaagcaaacaacgggtatctctctctcccca
gcggtgattgtcatcggtgaagtggtggggttacgggactatttgcaatcccccagtgaa
ccagaagtgccctcttctccggaagtggttattggtgaagagttgagggtggaagcgtgg
gacgttaaacctttacccgaattgaaggttgatacgtcgcccggtgaagagttgcccgtc
ttaaacctggaacagtggaacgttgaaccttcacccgaattgaatgatgacacattgccc
cctgaagagtcacccggatttaatgtggcacagtgggacgttaaacctttacccgaattg
aaggttgacaatccgccccctgaagagtcacccgacttgacaattgaacaactcaacatt
gaaatttcacaagccctagaggtgaacccgttgcccgttgaaccttctccagaaaactta
caacctgttaaccttcaacctgttaaccttcaactcgataacgtgcaaccttcccccctc
accccatcgttaccattgacgggtaaaaccgtcttagtcacccgttcagcgggacaatct
agccattttagctaccttctgcaacaagaaggagccgaggtgattgaaatgcctgccttg
gtgattactccgccgtctagttgggaggagttggatcatgcgatcgctcaactctataac
tttgattggttaattctcacctctagcaacggcgttgagtacttttttgaacgactgcac
gcccaaggaaaaaccaaccgtgccttaggtacggtgcaaattgcggtggtgggcaaaaaa
acagccgctagtcttaaagcacacggattggaacctgactttattcctcccaattttgtg
gcagattccctcgtcgagcacttcccagaacccctagagggtaaaagcatcttgtttccc
cgtgtggaaagcgggggcagagatgttttggtgaagcagattaccgcccaaggcgcagaa
gtcacagaagttgccgcctatgagtcagggtgccctgcccaaatggcacctgccgctaag
acagctctgcaacaacaaagggtagatattatcacctttgccagttccaaaaccgtcaag
cactttgttcaactcttagaaacatccctaccggaagatgccccagggcttcctattgcc
caatcccgactcgaaaacgtctgtgtcgcctccattggcccgcaaacgtccatcacttgc
cgtcaactgttggggcgagtggatgtggaagcccaggaatatactttagaaggtctgatt
caggcaattgtgcagtggacgacagacagatattga

DBGET integrated database retrieval system