KEGG   Microcoleus sp. PCC 7113: Mic7113_1854Help
Entry
Mic7113_1854      CDS       T02374                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
mic  Microcoleus sp. PCC 7113
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:mic00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Mic7113_1854
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Mic7113_1854
Enzymes [BR:mic01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Mic7113_1854
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2159689..2161191
Genome map
AA seq 500 aa AA seqDB search
MKLRQLLATIPNIVQMPDHPALEAEVKGLSTNSHACKAGDLFIGMPGTRVDGGEFWQSAI
ASGAIAALISTQAAEKSPSPEALGASACVISATDMTIACAEAAAAFYGYPGQQLKLIGVT
GTNGKTTTTHLIEFLLTHAQQPTALLGTLYTRWPGFQQTAVHTTPFPVELQQQLKSALEA
GCQLGVMEVSSHALAQGRVLGCSFEVGVFTNLTQDHLDFHRDMEDYFAAKALLFNANYLK
GRAIINIDDPYGKRLVEQLQPEQVWSYSVHDPSADLWTSDLNYESTGVSGILHTPAGEAP
FRSPLVGQYNLSNWLAAVGAVLQVGLKLETVVEALPQFMGVPGRMERVQIKPEQDVSVIV
DYAHTPDSLENLLKASRPFIQGKMICVFGCGGDRDRTKRPKMGKIAAELADVAVVTSDNP
RTEDPERILQDILEGIPSSVTPIVQGDRATAIRTAILQAQPGDGVLIAGKGHEDYQILGT
EKIHFDDREQAREALAERLA
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgaaattacgccaactattagctacgattcctaacattgtgcaaatgcctgaccaccca
gcactggaggctgaggtgaagggactctcgaccaattcccatgcctgtaaggcaggggat
ttatttattgggatgccaggaacacgggttgatggaggagagttttggcaaagtgcgatc
gcatccggtgcgatcgctgccctaatttctacccaagccgctgaaaaaagcccttctcca
gaagctttaggggcaagtgcttgtgtgatttctgcgacggatatgaccatcgcctgtgcc
gaagccgctgccgctttctatggatatccaggacagcaactcaagctgattggtgtgacg
ggtaccaacggtaaaaccacaaccacccatctcattgaatttctcctcactcatgctcag
caacctacagcacttctaggtaccctttatacccgttggcctggtttccaacaaacagcc
gttcatacaaccccgtttccggtggaactgcaacaacagctcaagtcagccttggaggca
ggatgccagttgggtgtgatggaagtcagttcccatgccttagctcaaggccgagtgctt
ggttgctcgtttgaggtcggagtgtttaccaatctaacccaagaccatttggacttccac
cgcgatatggaagattactttgccgccaaagcgcttttgtttaatgccaattatctcaaa
ggacgggcgattattaatattgatgacccctatggcaagcgattggtagaacaattgcag
ccagaacaggtctggtcttacagtgtgcatgacccctcggctgacttgtggacgagtgac
ctgaactatgaatcgactggggtgagtgggatactgcatacgcctgcgggtgaggctcct
ttccgttcgcctttggtgggtcagtacaatttatctaattggctggcggcggtaggagct
gttttacaggtgggtttgaagttagagacggtggtggaggcgctcccgcaatttatgggc
gttcctggacggatggagcgggtgcaaatcaagccagaacaggacgtgagtgtgattgta
gattatgctcatacgcccgatagtttggagaatttgctcaaggcatcgcgaccctttatt
cagggcaagatgatctgtgtgtttgggtgtgggggcgatcgcgaccgcacaaagcgtccc
aaaatgggtaaaattgccgccgaactcgctgatgtggcggtcgtgacttctgataatccc
cgcacggaagacccagagcgaattttacaagacatcctcgaaggaattccgtcatccgtg
acgcccattgtacaaggcgaccgcgccaccgccattcggactgctatcttacaagctcag
ccgggagacggtgttttaattgcagggaaaggtcacgaagattatcaaattctcggtact
gaaaaaattcactttgatgaccgagaacaggcacgagaggcacttgctgagcgattagcc
tag

DBGET integrated database retrieval system