KEGG   Microcoleus sp. PCC 7113: Mic7113_2273Help
Entry
Mic7113_2273      CDS       T02374                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
mic  Microcoleus sp. PCC 7113
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mic00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mic7113_2273
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Mic7113_2273
Enzymes [BR:mic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Mic7113_2273
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2600520..2601632
Genome map
AA seq 370 aa AA seqDB search
MSQTIVVKVGTSSLTQPQTGQLALSTIAKLVETLTHLRSSGHGIVLVTSGAVGVGCARLG
LKSRPQTMALKQAVAAVGQGRLMRIYDDFFTSLQQPIAQILLSRRDFIQRSCYVNAYGTF
RELLQLGVIPIVNENDTVAVEELKFGDNDTLSALVASLIQADWLFLLTDVDRLYSADPRQ
VPDAQPITLVNSMEHLAELQIQTGESGSQWGTGGMVTKISAARIATNAGVRTVITEGRYP
ESIEKILQGEPLGTQFEPQPRTENARKRWIAHSLVPVGKLYLDHGAVAAICQAGKSLLAA
GITAIEGEFHASEAVQLCDGSGLEIARGLVNYSSTELQKIRGRKSEDIPMILGYGGAETV
VHRDNLVLSN
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaaacgattgttgttaaagttggtacctccagcctcacccaaccccaaactggt
cagttagcgctctcgaccattgccaaactcgttgaaactctcactcatctgcgctcctca
ggtcatggcatcgttctagtgacctctggggctgtgggtgttggttgtgcgcgattgggg
ttaaagtcgcgccctcagacaatggcgctcaaacaagccgtagcagcagtcggacaggga
cgtttgatgcgaatttacgacgatttctttaccagcttgcaacagccgatcgcacaaatc
ctcctcagccgccgtgacttcatccaacggagttgctacgtcaatgcctacggaacattt
cgagaactgctccagttaggagtaatcccgattgtgaatgaaaacgacaccgtggcggtt
gaggaactcaagtttggagataatgatactctcagcgctttagttgccagtctcattcaa
gccgattggttgtttttgctcacggatgtagaccgactgtactccgccgatccgcgccaa
gtccccgatgctcagccgattaccctggtaaacagcatggagcacttagcggaacttcag
attcaaaccggagaatccggctctcagtgggggacaggtggcatggtgaccaaaatttca
gcggcgcggattgccaccaatgcgggggtgaggactgtcatcacagaaggacgctaccct
gaatcgatcgaaaaaatcttacagggagaacccctcggtacccaatttgaaccccaacct
cggactgaaaatgctcgtaagcgttggattgctcacagtttagtgcctgtgggtaagctg
tatcttgatcatggagctgtcgcggcaatttgtcaggcggggaaatccttgttagcggca
ggcattacagccattgagggggagtttcacgcttcggaggcggtacagttatgcgacggc
agtggcttagaaattgcgagagggttggttaactacagcagcaccgaacttcagaagatt
cgagggcggaaatccgaggatattcctatgattttgggctatgggggcgctgaaacggtg
gtacatcgcgataacctggtgttgagtaattag

DBGET integrated database retrieval system