KEGG   Microcoleus sp. PCC 7113: Mic7113_3022Help
Entry
Mic7113_3022      CDS       T02374                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
mic  Microcoleus sp. PCC 7113
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:mic00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mic7113_3022
Enzymes [BR:mic01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Mic7113_3022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3498861..3499499
Genome map
AA seq 212 aa AA seqDB search
MTLSISPDDIRKQTISTQAKSPVSEEEMRQAVRTLLLGMGEDPDREGLRDTPKRVVKALK
FLTSGYHQSLDELLNGAVFHEDANEMVLVRDIDLFSSCEHHILPILGRAHVAYIPNGKVI
GLSKIARICEMYARRLQVQERLTAQIADAIQGLLKPQGVAVVVEATHMCMVMRGVQKPGS
WTVTSSMQGVFADDAKTRQEFMDLIRHRPSFH
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgacattatctatttcaccggacgatatccgcaagcaaaccattagcactcaagccaag
tctcccgtttctgaagaagaaatgcggcaagcggttcgcacattgctattgggcatgggt
gaagaccccgatcgcgaagggcttcgtgatacccccaaacgagtagtcaaagcgctcaaa
ttcttaacctctggctaccaccaatccctagatgagttgctcaatggggctgttttccat
gaagatgccaacgaaatggtattagtgcgcgacattgatttgtttagttcctgtgagcat
cacattctaccgattttgggacgtgctcatgtagcttatattcccaatgggaaagtgatt
ggcttatccaaaattgcccgaatttgtgaaatgtatgcccgtcgcttgcaagtacaggaa
cgactcactgcacaaattgccgatgctattcaaggattgcttaaaccgcaaggggttgcc
gtagtcgttgaagctactcatatgtgtatggtgatgcggggcgtgcaaaaacccggttct
tggacagtgacaagttcgatgcaaggcgtatttgccgacgatgccaaaacccgtcaggaa
tttatggatttgattcgtcacagaccatccttccactaa

DBGET integrated database retrieval system