KEGG   Microcoleus sp. PCC 7113: Mic7113_3187Help
Entry
Mic7113_3187      CDS       T02374                                 

Definition
pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mic  Microcoleus sp. PCC 7113
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mic00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mic7113_3187
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mic7113_3187
   00020 Citrate cycle (TCA cycle)
    Mic7113_3187
   00620 Pyruvate metabolism
    Mic7113_3187
Enzymes [BR:mic01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Mic7113_3187
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3657277..3658590)
Genome map
AA seq 437 aa AA seqDB search
MIHEVFMPALSSTMTEGKIVSWVKSPGDRVEKGETVVVVESDKADMDVESFYEGYLAVIT
VPAGESAPVGAAIALLAESEAEIEQVKQQAAQSSQGTAVSTPQKDSVPTPTPGQVEAAPV
AAQDTPSPRNGRIVASPRARKLAKELRVDLNSLKGSGPYGRVIAEDVEAAAGKGSTPAAT
PAATTTAPKPTSTPAPTTPAPRPAPTPAVPVAALGETVPFNTLQNAVVRNMVASLQVPTF
HVGYTITTDELDKLYKKIKTKGVTMTALLAKAVAVTLQKHPLVNASCVEQGIQYHSSINI
AVAVAMPGGGLITPVLQQADQVDIYSLSRNWKDLVERARLKQLQPEEYSSGTFTLSNLGM
FGVDRFDAILPPGQGSILAIGASRPSVVATEEGMMGVRRQMQVNITCDHRIIYGADAAAF
LQDLAKLIETDPQSLTL
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgatccacgaagttttcatgcccgccctcagttccacaatgaccgaaggcaaaatagtc
tcttgggtaaaatctccaggggaccgagttgagaaaggcgaaacggtggtggtggttgag
tcagataaggcagatatggacgttgagtccttctatgaaggttatctggctgtgatcacg
gtaccggctggtgaatcagctcccgtaggggcggcgatcgcacttttggcagaatcggaa
gctgaaattgagcaagttaaacaacaagcggctcaatccagccagggtactgctgtttcc
acccctcaaaaagactcggtacccacaccgacgcctggacaagtagaggctgccccagtg
gcggctcaagatacacccagccctcgcaatggacggattgtcgcctcacctcgcgctcgc
aagttagccaaggaactccgcgtcgatctcaacagcctcaaaggcagtggcccctatggg
cgggttattgccgaggatgtggaagccgccgccgggaaagggagtactcctgccgctacg
cctgccgcgacgacaacagcaccgaaaccaacctcaacccccgcgccaactacccctgca
cctcgtccagcccccaccccagcggttcctgttgctgccttgggtgaaaccgtaccgttt
aatacgctgcaaaatgcggtggtacggaatatggttgccagccttcaggtgcctaccttc
cacgttggctataccattacaaccgatgagctggataagttatacaaaaaaatcaagacc
aaaggcgtgacgatgacggcactgctggctaaggccgtggcggttacgttacaaaaacat
cctttggtcaatgccagttgtgtagaacagggcattcagtatcacagttccatcaatatt
gccgtcgcggtggcaatgcctggtggaggactgattacgccggtcttacaacaagctgac
caagttgatatttattccctatctcgcaattggaaagacttggtagaacgtgccagactc
aagcagttgcagccggaggaatatagctctggtaccttcacgctgtccaatttgggcatg
tttggggttgaccgttttgatgctattttaccgccaggacaagggtcaattttggcgatc
ggggcatcacgtcctagcgttgtggcaacggaggagggaatgatgggtgtgcggcgtcag
atgcaggtgaatatcacttgtgaccaccggattatttacggtgctgatgcggcagcgttc
ctgcaagacttggcgaagttgattgaaaccgatccgcaatcgttaacgctttag

DBGET integrated database retrieval system