KEGG   Microcoleus sp. PCC 7113: Mic7113_3584Help
Entry
Mic7113_3584      CDS       T02374                                 

Definition
(GenBank) methylase of chemotaxis methyl-accepting protein
  KO
K13924  two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
mic  Microcoleus sp. PCC 7113
Pathway
mic02020  Two-component system
mic02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:mic00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mic7113_3584
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Mic7113_3584
Enzymes [BR:mic01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Mic7113_3584
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Mic7113_3584
Two-component system [BR:mic02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Mic7113_3584
Bacterial motility proteins [BR:mic02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Mic7113_3584
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheR PAS CheR_N PAS_4 PAS_10 PAS_9 Spc7 Mnd1 WEMBL IncA APG17 HAUS-augmin3 GAF_2 HMMR_N PAS_7 Rootletin Syntaxin-6_N OmpH Fez1 Tropomyosin Golgin_A5 Laminin_II Exonuc_VII_L Sec8_exocyst HOOK PAS_8 Methyltransf_12 IFT57 Filament DUF3584 DUF812 APG6 DUF1664 Atg14 FapA HemX MCPsignal TPR_MLP1_2 LMBR1 ATG16 KASH_CCD Reo_sigmaC Jnk-SapK_ap_N PCRF DDHD Sec34 DUF4795 UPF0449 DUF5089 CALCOCO1 CENP-F_leu_zip DASH_Duo1 RPW8 DUF4407 DUF3053 DUF3450 TMPIT STAT_alpha TBPIP THOC7 Lebercilin DUF16 LXG DUF2203 AAA_13 Bap31 DUF3552 Fmp27_WPPW Fzo_mitofusin V_ATPase_I Tropomyosin_1 FUSC
Motif
Other DBs
NCBI-ProteinID: AFZ19308
UniProt: K9WGI3
Position
4141646..4143508
Genome map
AA seq 620 aa AA seqDB search
MAITPDDPTFEVLLHYLKQTRGFDFTGYKRPSLMRLAKKRMQIVGAESFTQYLDYLEANP
LELNHLFDALLLNVTTFFRDLPAWNYLTQEIIPRILEMKPDNELIRVWTAGCASGEEAYT
IAIILAEILGEEAFRSRVKIYATDLDEDAITYGRLATYTARQLGNIPEPLREKYFEVTRS
AYIFRHDLRRCVIFGRNNLVQDAPIGHLDLLICRNTLMYFNAETQSRVLARFHFALKDRG
FLFVGKAEMLLTHANLFTPVNLKYRIFAKLSHVTLRDRQFVLAEAGNTEIGNHTLRNIRL
RDEAIESLPIAQIVVDIHGKLAIANRQARIWFNISNSDLERPLQDLEVSYRPAELRSLIQ
KAYTERRPIQLNHVEFSKVGESNPIWLDIEILPLMDTQGELLGVLVVFQDATRYNQLQQE
LSRSTQEVETAYEELQSANEELETTNEELQSTNEELETTNEELQSTNEELETINEELQSS
NEELQATNDELRARTDELNCANAFLESILTSLQMGMVVLNNRLSVQLWNGEAVNLWGIPA
SEVEGYFFFDLDLGLPLEQLREPVRECQTGVSNYRDMVLDAINRRGRAIRCRVICTPLIV
AAQQQGIILLMEDVSNKQQP
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atggctataactccagacgatccaacctttgaagtattactgcactatctcaaacaaact
cgcggtttcgacttcaccggttataagcgtccgtcactgatgcgcttggcgaaaaagcgg
atgcaaatcgtgggggcagagtcgtttacgcagtatctggattacctagaggcaaatcca
ctcgaactcaaccatctatttgatgctctattgttgaacgtcactacgtttttccgggat
ttacccgcatggaactatctcactcaagagataattccccgaattctggaaatgaagcca
gacaatgaactcattcgagtttggacggctggctgtgcgtccggtgaggaagcctatacc
attgctatcattctggcggaaattcttggagaagaggcattccgatcgcgggtgaaaatc
tacgccaccgatttggatgaagacgctattacttatggtcgccttgccacttatacagcc
agacaattaggaaatattcccgaacctctgcgcgagaaatacttcgaggtaacacgcagt
gcttacatattccgccatgatttgcgccgatgtgtgatttttggtcgcaataacttggtt
caggatgctcccattgggcatctagatttgctgatttgccgcaataccctgatgtatttc
aatgcggagactcaatcgcgtgtcctcgcccgctttcacttcgctctcaaagacagggga
tttttatttgtgggcaaggcggagatgctgctgactcatgccaatctcttcacaccggtt
aacctcaagtatcgaatttttgccaaactctcccacgtgacactgcgcgatcgtcaattt
gttcttgcagaagcgggcaacaccgagataggtaaccatacactcagaaatatccgtttg
cgggatgaagccatcgagagtctacccatcgcccaaattgtggtggatatccatggtaag
ctagccatcgccaaccgacaggctcgcatttggtttaatatctccaactcagatttggag
cgccctctacaggatttagaagtctcatatcgaccggctgaactgcgatcgctgatccaa
aaagcttacaccgaacgccgccccatccagctcaatcatgtggaattctcgaaagtgggc
gagagtaatcccatctggttagacattgagattctccctttaatggatactcagggtgaa
ctcttgggcgtgttagtggtattccaggatgcaacacgctacaaccagttgcaacaggaa
ctttcacgttccactcaggaagtggaaacggcttacgaagaacttcagagtgccaacgaa
gaactagaaaccaccaacgaagagctccaaagtaccaacgaagaattggaaaccaccaat
gaagaactccaaagtactaacgaagaattggagaccattaatgaagaactccaatcttct
aacgaggaacttcaagccacgaatgacgaactgcgtgctcgcaccgatgaactcaactgt
gctaacgcctttttggaatccattcttaccagtctacagatggggatggtcgttttaaac
aaccgcctttctgttcaactttggaacggtgaagccgtcaatttatggggaattcccgcg
agtgaggttgaaggatatttcttctttgacctagatttgggcttgcccctagagcaactt
agggaacccgtccgtgagtgtcagactggagtatcgaattaccgagacatggtattagac
gcgattaaccgccgtggcagagccattcgttgccgggtgatctgcacacccctgattgtg
gcggctcagcaacaaggcatcattcttttaatggaagacgtgagcaacaaacaacagccg
taa

DBGET integrated database retrieval system