KEGG   Microcoleus sp. PCC 7113: Mic7113_3654Help
Entry
Mic7113_3654      CDS       T02374                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
mic  Microcoleus sp. PCC 7113
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:mic00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4231934..4232887
Genome map
AA seq 317 aa AA seqDB search
MRSYSLIAPAKINLYLEILGDRPDGYHELAMILQSIELADQIEVRAIGTDTILIHCDHPQ
VPSDSSNLAYRAVELMAKVFPDAFAKFGGVEITIKKHIPVAAGLAGGSTNAAAVLVAVDM
MWQLGLTQPELQDLAAQLGSDVPFCLAGGTALATGRGEQLNSLSAFNSLYVVLAKDRNLM
ISTPWAYQAYRSEFGHTYVRDTQSLESRAHRVHSGPIVNAIRHKDGSQIGRLLHNDLEKV
VLPTTPQVAQLREAFQSSGVLGTMMSGSGPTVFALCESEAHAQEVRQRVRGMIANPDVDF
WVTRFSTRGIQIVSSVT
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcgctcctactccctaattgccccagccaaaatcaatctgtatttggaaattctaggt
gatcgcccagatggatatcacgagttggcgatgattcttcagagcatcgagttagccgac
caaattgaagttcgtgcgatcggtaccgatactatcctcattcactgcgaccatccccaa
gtgccgagtgactcaagcaaccttgcctaccgagccgtagaattgatggcgaaggtcttt
cccgatgccttcgcaaaatttggtggtgtggaaattaccatcaaaaaacatattcctgta
gcggctggactggcgggaggttcgaccaatgctgccgctgttttagtggcagtagatatg
atgtggcagttgggactcacccagccggaattacaagacttagccgcacaacttggctct
gatgttccgttttgtttggcaggtggcacggcgctggcgacgggtcgaggtgagcaactg
aattctctatcagctttcaattcgctttatgttgttttagcgaaagaccgaaatctgatg
atttcgaccccgtgggcttatcaggcttatcgctctgagtttggtcatacttatgtgcgc
gatacacagagtttggaatcccgcgcccatcgagttcattcggggccgatagttaacgcg
attcgccacaaggatggctcacaaattggtcggttgctgcacaatgatttagaaaaagtg
gtgctgcccaccactccccaagtggcacaactgagggaagcgtttcaaagtagcggtgtt
ttgggaacgatgatgtctggatcggggccaactgtatttgctctgtgcgagtcggaggct
cacgcgcaggaggttcggcaaagagtcaggggcatgattgccaacccagatgtggatttc
tgggtgacacggttctcaacacggggcattcagattgtctcgtcggttacttga

DBGET integrated database retrieval system