KEGG   Microcoleus sp. PCC 7113: Mic7113_3654Help
Entry
Mic7113_3654      CDS       T02374                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
mic  Microcoleus sp. PCC 7113
Pathway
mic00900  Terpenoid backbone biosynthesis
mic01100  Metabolic pathways
mic01110  Biosynthesis of secondary metabolites
mic01130  Biosynthesis of antibiotics
Module
mic_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:mic00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mic7113_3654
Enzymes [BR:mic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Mic7113_3654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: AFZ19376
UniProt: K9WHT7
Position
4231934..4232887
Genome map
AA seq 317 aa AA seqDB search
MRSYSLIAPAKINLYLEILGDRPDGYHELAMILQSIELADQIEVRAIGTDTILIHCDHPQ
VPSDSSNLAYRAVELMAKVFPDAFAKFGGVEITIKKHIPVAAGLAGGSTNAAAVLVAVDM
MWQLGLTQPELQDLAAQLGSDVPFCLAGGTALATGRGEQLNSLSAFNSLYVVLAKDRNLM
ISTPWAYQAYRSEFGHTYVRDTQSLESRAHRVHSGPIVNAIRHKDGSQIGRLLHNDLEKV
VLPTTPQVAQLREAFQSSGVLGTMMSGSGPTVFALCESEAHAQEVRQRVRGMIANPDVDF
WVTRFSTRGIQIVSSVT
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcgctcctactccctaattgccccagccaaaatcaatctgtatttggaaattctaggt
gatcgcccagatggatatcacgagttggcgatgattcttcagagcatcgagttagccgac
caaattgaagttcgtgcgatcggtaccgatactatcctcattcactgcgaccatccccaa
gtgccgagtgactcaagcaaccttgcctaccgagccgtagaattgatggcgaaggtcttt
cccgatgccttcgcaaaatttggtggtgtggaaattaccatcaaaaaacatattcctgta
gcggctggactggcgggaggttcgaccaatgctgccgctgttttagtggcagtagatatg
atgtggcagttgggactcacccagccggaattacaagacttagccgcacaacttggctct
gatgttccgttttgtttggcaggtggcacggcgctggcgacgggtcgaggtgagcaactg
aattctctatcagctttcaattcgctttatgttgttttagcgaaagaccgaaatctgatg
atttcgaccccgtgggcttatcaggcttatcgctctgagtttggtcatacttatgtgcgc
gatacacagagtttggaatcccgcgcccatcgagttcattcggggccgatagttaacgcg
attcgccacaaggatggctcacaaattggtcggttgctgcacaatgatttagaaaaagtg
gtgctgcccaccactccccaagtggcacaactgagggaagcgtttcaaagtagcggtgtt
ttgggaacgatgatgtctggatcggggccaactgtatttgctctgtgcgagtcggaggct
cacgcgcaggaggttcggcaaagagtcaggggcatgattgccaacccagatgtggatttc
tgggtgacacggttctcaacacggggcattcagattgtctcgtcggttacttga

DBGET integrated database retrieval system