KEGG   Microcoleus sp. PCC 7113: Mic7113_3659Help
Entry
Mic7113_3659      CDS       T02374                                 

Definition
glutathione S-transferase
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
mic  Microcoleus sp. PCC 7113
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:mic00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Mic7113_3659
Enzymes [BR:mic01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Mic7113_3659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4235743..4236405
Genome map
AA seq 220 aa AA seqDB search
MLKLYHIPLSANSRRVWITLLEKGLPFEEIVLKLDGDQYQSEFLEISPFHHIPVLVDDGF
RVVESLAILDYLEAKYPTPSLMPTDTKAIATVRMVELVTINELLPPTIRLTSQALGVLEN
APQKVEKAHQQVLTVLDFFESLLGDSPYFASEFLTLGDIAAGTVVPQLPSIGVSLDDYPK
LKAWCDRLMARDSWQKTQPSPEAIATSLPQIKALMKAYLM
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgctaaagctttatcatatccctctgtctgcaaactctcgccgtgtgtggattacactc
ctagaaaaaggactgccttttgaggagattgtactcaaattagatggtgatcaatatcaa
tccgagtttcttgaaattagcccatttcaccatattcctgttttagtcgatgatggcttt
agggtagtagaatctttggcgattcttgactacctggaagccaagtaccctacaccctca
cttatgcctactgataccaaagcaatcgcaactgtacgcatggtggaactcgtcacgatt
aatgaactcttacctcccacgattcgattgacgagtcaggcgctaggtgtattggaaaat
gcaccccaaaaggtggagaaggctcatcagcaagtcctcacggtactggatttctttgaa
agcttactcggtgattctccctattttgctagcgaattcctaaccctgggtgatattgcc
gctggaacagtagtgcctcagcttcccagtataggtgtctcgctggatgactatccaaaa
ctcaaggcttggtgtgatcgtttaatggcgcgtgattcgtggcaaaaaactcagccgagt
ccggaagcgatcgcaacgtctctgcctcagatcaaagcactcatgaaagcttatttgatg
taa

DBGET integrated database retrieval system