KEGG   Microcoleus sp. PCC 7113: Mic7113_3739Help
Entry
Mic7113_3739      CDS       T02374                                 

Definition
(GenBank) alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mic  Microcoleus sp. PCC 7113
Pathway
mic00500  Starch and sucrose metabolism
mic01100  Metabolic pathways
mic01110  Biosynthesis of secondary metabolites
Module
mic_M00565  Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:mic00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mic7113_3739
Enzymes [BR:mic01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Mic7113_3739
Exosome [BR:mic04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mic7113_3739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase_C CBM_48 Alpha-amylase Glyco_hydro_70 AMPK1_CBM
Motif
Other DBs
NCBI-ProteinID: AFZ19458
UniProt: K9WGY0
Position
4329053..4330996
Genome map
AA seq 647 aa AA seqDB search
MTYQLSVNQTQPQVTDGYVSLLTEDDLYLFNEGSHFHLYEKLGSHPVVVNGERGTYFAVW
APNATEVFVKGDFNGWQDNGHRLSLKGNSGIWEGFIPGMTKGSLYKYHIVNHNSGYAVDK
ADPFANSQEVPPRTGSVVWDTEYTWHDQEWMEKRDRIQALDAPMSIYEVHLGSWMRVPEE
GNRYLTYRELASKLAEYIKQMGFTHVELMPITEHPFYGSWGYQTTGYFAPTSRYGSPQDF
MYMVDYLHQQGIGVILDWVPSHFPTDQHGLNYFDGTNLYEHADPRQGFHPDWQSSIFNYG
RHEVRSFLISSAFFWLDKCHIDGLRVDAVASMLYLDYSRKEGEWIPNQYGGRENFEAIEF
LRRFNEAVYKHFPGIQTIAEESTSWPMVARPLYVGGLGFGLKWDMGWMHDTLSYMSQEPI
HRKYHHNKLTFRMLYAFNENFALPLSHDEVVHGKGSLIGKMPGDYWQKFANLRLLFGYMY
AQAAKKLLFMGGEIGQWSEWNHDQSLDWNLLENPMHGGLQKWVADLNHTYRTEPALHELD
FDWQGFDWIDCNDTEQSVISLVRKGKSAEDVVLAVCNFTPVPRYNYRIGVPAEGFWQELL
NSDAGDYGGSGMGNMGGKQAEAISQHGQPYSVDLTLPPLAIAFFKLC
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgacttatcaattatcagtcaatcaaactcaaccgcaagtgaccgacggttatgtcagc
ttgctaacggaggatgacctttatctgtttaatgaagggtcacacttccacctttatgaa
aaattaggctctcaccccgtcgtggtcaatggcgaaaggggaacctattttgccgtgtgg
gcacccaatgcgactgaggtatttgttaaaggggatttcaacgggtggcaggataatggt
caccgcctatctctgaaaggaaactccgggatttgggaaggctttattcctggaatgacc
aaaggtagcctctacaagtaccacattgtcaaccacaatagtgggtacgcggtagataaa
gccgatccctttgccaattctcaagaagtgccgccgagaaccggttcagtggtttgggat
acggaatacacttggcatgaccaagagtggatggaaaagcgcgatcgcatacaagccctc
gacgcccccatgtccatctacgaggtacacttaggctcttggatgcgagtgccggaagag
ggaaatcgctacctcacctaccgagaactggcctcaaaactggctgagtatatcaagcaa
atgggattcacccatgttgaattgatgccgattaccgagcatcctttctatgggtcttgg
ggttatcaaacaacgggttattttgctccaaccagccgctatggtagtccccaagacttc
atgtatatggtggattacctgcatcagcaaggcattggtgtgattttagattgggtgccg
tctcatttccccaccgatcagcatggactgaactattttgatgggacaaacctctatgaa
catgctgacccccgccaaggcttccatcccgactggcagagtagcatttttaactatggt
cgccatgaagtccgcagttttttgattagcagtgcctttttctggctcgacaagtgccat
attgatggactacgggtggatgccgtcgcctcgatgctgtatttggactactcccgcaaa
gaaggagagtggattcccaatcaatacggcggcagggaaaattttgaggcgatcgagttt
ctacgccgctttaatgaagcggtttacaagcacttccccggtattcaaaccattgccgaa
gagtctacctcttggccgatggttgcccgtcccctgtatgtggggggtctagggtttgga
ctgaaatgggacatgggttggatgcatgacaccctcagctatatgtcccaagaaccgatc
caccggaagtaccatcacaataaactcaccttccggatgctttacgcctttaacgagaac
ttcgccctacccctgtctcatgatgaagtggtgcatggtaagggttcgctgattggcaaa
atgccgggagattactggcagaaatttgccaatttacgcttgctttttggctacatgtat
gctcaagcggcgaagaagctgttgtttatgggtggggaaattggtcagtggtcggaatgg
aaccatgatcaaagcttagactggaatcttttagagaatcccatgcacgggggtttgcaa
aagtgggtggctgacttaaaccacacttatcgcactgaacccgccctgcatgaattggat
tttgactggcaagggtttgactggattgattgtaatgacacagagcaaagtgtgattagt
ttggttcgcaagggtaagtctgccgaagatgtggtgttagccgtttgtaactttacccct
gtaccccgctacaactaccgcatcggtgttcctgctgaaggattctggcaggagttactc
aacagcgatgccggggactatggtggcagtggcatgggtaatatggggggcaaacaagca
gaggccatttctcaacatggtcagccctactcggtggatctgaccttacccccgttggcg
atcgcttttttcaaactttgttaa

DBGET integrated database retrieval system