KEGG   Microcoleus sp. PCC 7113: Mic7113_3878Help
Entry
Mic7113_3878      CDS       T02374                                 

Definition
formamidopyrimidine-DNA glycosylase Fpg
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mic  Microcoleus sp. PCC 7113
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:mic00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Mic7113_3878
Enzymes [BR:mic01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     Mic7113_3878
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Mic7113_3878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4490703..4491662)
Genome map
AA seq 319 aa AA seqDB search
MPELPEVETVCQGLNQMTLNQEIWGGDVLLTRTIAYPFSMGEFLAHLKNVAITRWHRRGK
YLLAQLAHSDSKYQTGVMSQESMPQIHLRENLPKSNSPNLQSSDGGWLGVHLRMTGQLLW
LNREQPLHKHTRVRLFFPNNQELRFVDQRTFGKMWWVPPSVPLESIITGLKQLGPEPFSE
QFSLEYLAGKLRHRQRSIKAALLDQTLVAGVGNIYADEALFLSGIRPDTLCADLNPEQIE
RIRSSLIQVLQASIQVGGTTFSNFLNVQGVNGNYGGVAWVYGRTGELCRVCHRSIVRLKV
AGRSSHFCPNCQQLPTAKR
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgaactgcctgaagttgaaactgtttgtcagggtcttaatcaaatgaccctgaat
caagaaatttggggtggggatgtgttgctgacacgcaccatcgcctaccccttttctatg
ggtgagtttttagcacacctgaagaatgttgcgattacccgttggcatcgtcgcggtaag
tatttactggcacaactggctcactcagactccaaataccaaacaggagtcatgagtcag
gagtcaatgcctcaaattcatctgagggaaaacctgcctaaatccaacagtccaaatctc
caatcgtctgatggcggatggttgggagtgcatttacgcatgaccggtcaactgctgtgg
ctcaatcgcgagcaacctctacacaaacacacaagagtgcgattgtttttccccaataac
caggagttacgctttgttgaccagcggacgtttggcaagatgtggtgggttccgccctcc
gtgcctttagaaagtattatcacaggattgaagcaactggggccagagccgttttcagag
cagttttccctggaataccttgctggtaagctacgtcatcgtcagcgttctattaaagcc
gcactgttggatcaaacccttgttgcaggcgtgggtaatatttatgccgatgaagcccta
tttttaagcggcatccgccctgatacgctttgtgcagatttgaatccagaacagatcgag
cgtatccgctccagtttaattcaagtgttacaagcgagcatccaggtgggtggcacgacc
tttagtaactttctcaacgtgcaaggggtgaatgggaattacggtggtgtagcctgggtg
tatggtcgcacgggtgaactctgccgcgtttgtcatcgctccatcgtccgcctcaaggtg
gcggggcgatcctctcatttttgtccaaactgtcagcaacttcccactgctaagcgttaa

DBGET integrated database retrieval system