KEGG   Microcoleus sp. PCC 7113: Mic7113_3964Help
Entry
Mic7113_3964      CDS       T02374                                 

Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mic  Microcoleus sp. PCC 7113
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mic00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mic7113_3964
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mic7113_3964
   00640 Propanoate metabolism
    Mic7113_3964
   00660 C5-Branched dibasic acid metabolism
    Mic7113_3964
Enzymes [BR:mic01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Mic7113_3964
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4603566..4604831)
Genome map
AA seq 421 aa AA seqDB search
MDLLEYQAKELFREIGIPVLPSQRIDHPTDLKRLEIPYPVVLKSQVPTGGRGRAGGIRFV
ENTIDAIAAARAIFNLPILGRYPQVLLAESRYDAERELFLAVILDYTLGRPVLLGSSQGG
INVEAVIQHMQKVVVEQEFSSFYARRLALKMGLQGQLIESVSGVIQKMYQLFLQKDLDLV
EINPLGISSTGEVMALDGKIAANDNALGRHTELASLASIIPNSSSQRVPNLNWTDTEGNI
GILCNDACLAAATLDLVYQEHGKPASCLILDGSTRWDVPAESSPVQQLQSALKQITEAKG
IKVILVNILSSANASEQVAQVIANYLLPKVGEVSALKAVEQADRPRGMTARTHRTQNNGT
HTLSKQPVSLSPLPHFVIRIVGGQIDSAKERLAAIPVHWRDNLDEAVAQAISLANSKVRQ
S
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggacttattagagtaccaagcgaaagaattatttcgcgagattggcatccctgttttg
ccgtctcaacgcatcgaccatcctaccgacctcaagcgcttagaaattccttatccggtc
gtcctcaagtctcaggtgcctacaggaggaaggggtagagccggtggtatccgctttgtg
gaaaataccattgatgcgatcgcggcagcaagagctattttcaaccttccgattctcggt
cgctatccccaagtcctgctcgccgaatcccgctatgatgctgagcgggaattgtttctc
gccgtcatcctcgactatacccttgggcgtcctgtcctcttagggtcttcccaaggaggc
attaacgtagaagccgtgattcaacacatgcaaaaggtagtggtggagcaagaattctcc
tccttttatgcgcggcgtctcgccctgaaaatgggactccaaggacagctcattgagtcg
gttagtggggttatccaaaaaatgtaccagctatttctccaaaaagacctggacttagtg
gaaattaatcccctaggcattagttccacgggtgaggtgatggcattggatggcaaaatt
gcggcaaatgacaatgctttggggcgtcataccgagttagccagcttggcatccattatt
ccgaatagctcctctcagcgagtgcctaacctcaactggacggacacagaaggcaatatt
gggattttgtgtaacgatgcttgtctggctgctgcgaccttagatttggtctaccaagaa
catgggaaacccgctagttgtctgattttggacgggtctacccgttgggacgtgccagcc
gagtcctctcccgtacaacaactgcaaagtgcgctcaagcaaattacagaagccaaaggg
attaaagttatcttagtcaacattttgagcagtgcgaacgccagtgaacaagtggctcag
gtcattgcgaattatttgcttcctaaagtgggggaagtgtctgcgctcaaggcagtagag
caggcagatagaccgaggggaatgacggctcggactcatcgtactcaaaataatgggact
catacgctctctaagcaacctgtatctctcagtccgctccctcactttgtcatccggatt
gtgggagggcaaattgactcggctaaagaacgtctggcagcgataccggtacattggagg
gataacttggatgaggcagtagcccaagcgatttccctggccaactccaaggtgaggcag
tcttaa

DBGET integrated database retrieval system