KEGG   Microcoleus sp. PCC 7113: Mic7113_3964Help
Entry
Mic7113_3964      CDS       T02374                                 

Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mic  Microcoleus sp. PCC 7113
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:mic01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mic00020]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mic00640]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism [PATH:mic00660]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4603566..4604831)
Genome map
AA seq 421 aa AA seqDB search
MDLLEYQAKELFREIGIPVLPSQRIDHPTDLKRLEIPYPVVLKSQVPTGGRGRAGGIRFV
ENTIDAIAAARAIFNLPILGRYPQVLLAESRYDAERELFLAVILDYTLGRPVLLGSSQGG
INVEAVIQHMQKVVVEQEFSSFYARRLALKMGLQGQLIESVSGVIQKMYQLFLQKDLDLV
EINPLGISSTGEVMALDGKIAANDNALGRHTELASLASIIPNSSSQRVPNLNWTDTEGNI
GILCNDACLAAATLDLVYQEHGKPASCLILDGSTRWDVPAESSPVQQLQSALKQITEAKG
IKVILVNILSSANASEQVAQVIANYLLPKVGEVSALKAVEQADRPRGMTARTHRTQNNGT
HTLSKQPVSLSPLPHFVIRIVGGQIDSAKERLAAIPVHWRDNLDEAVAQAISLANSKVRQ
S
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggacttattagagtaccaagcgaaagaattatttcgcgagattggcatccctgttttg
ccgtctcaacgcatcgaccatcctaccgacctcaagcgcttagaaattccttatccggtc
gtcctcaagtctcaggtgcctacaggaggaaggggtagagccggtggtatccgctttgtg
gaaaataccattgatgcgatcgcggcagcaagagctattttcaaccttccgattctcggt
cgctatccccaagtcctgctcgccgaatcccgctatgatgctgagcgggaattgtttctc
gccgtcatcctcgactatacccttgggcgtcctgtcctcttagggtcttcccaaggaggc
attaacgtagaagccgtgattcaacacatgcaaaaggtagtggtggagcaagaattctcc
tccttttatgcgcggcgtctcgccctgaaaatgggactccaaggacagctcattgagtcg
gttagtggggttatccaaaaaatgtaccagctatttctccaaaaagacctggacttagtg
gaaattaatcccctaggcattagttccacgggtgaggtgatggcattggatggcaaaatt
gcggcaaatgacaatgctttggggcgtcataccgagttagccagcttggcatccattatt
ccgaatagctcctctcagcgagtgcctaacctcaactggacggacacagaaggcaatatt
gggattttgtgtaacgatgcttgtctggctgctgcgaccttagatttggtctaccaagaa
catgggaaacccgctagttgtctgattttggacgggtctacccgttgggacgtgccagcc
gagtcctctcccgtacaacaactgcaaagtgcgctcaagcaaattacagaagccaaaggg
attaaagttatcttagtcaacattttgagcagtgcgaacgccagtgaacaagtggctcag
gtcattgcgaattatttgcttcctaaagtgggggaagtgtctgcgctcaaggcagtagag
caggcagatagaccgaggggaatgacggctcggactcatcgtactcaaaataatgggact
catacgctctctaagcaacctgtatctctcagtccgctccctcactttgtcatccggatt
gtgggagggcaaattgactcggctaaagaacgtctggcagcgataccggtacattggagg
gataacttggatgaggcagtagcccaagcgatttccctggccaactccaaggtgaggcag
tcttaa

DBGET integrated database retrieval system