KEGG   Microcoleus sp. PCC 7113: Mic7113_3971Help
Entry
Mic7113_3971      CDS       T02374                                 

Definition
L-glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
mic  Microcoleus sp. PCC 7113
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mic00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mic00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:mic00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4611490..4612521
Genome map
AA seq 343 aa AA seqDB search
MAEKHDFQSLASSIQAVASPFRSYLNDLHEKYQSLNEGTVADYIPELALADPNWFGICAV
TVEGQVFEVGNCKQLFTIQSISKAFVYGLALEDHGREYVNSKVSVEPTGEAFNSIVLDEK
TNRPYNPMVNAGAIATADLIKGNGGTERLKRLLDMFQRYTGREHDINVPVFLSEKATGHR
NRAIAYLMRNFGMISEQIDETLDLYFQQCSMMVNGRDLAMMAATLANGGMNPITQERAID
ERYVQDVISVMLTCGMYDYSGEWTYRVGMPAKSGVGGGITAVVPGKLGIGTFSPPLDVKG
NSVRGIKVCENLSRDFGLHLFNAAKPERDLEAWIEGSDSIDSW
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaaacacgattttcagtccctagctagttccattcaggcggttgcttctcca
tttcgttcctatctaaacgatcttcatgaaaaatatcaatccctgaatgaaggtactgtt
gctgactatattcctgaactcgctttagctgaccctaattggttcgggatttgtgctgta
accgtagagggtcaggtgtttgaggtgggtaattgcaaacaattattcaccattcagtct
atttccaaggcgtttgtttatggcttggcgctggaagatcatggtcgagagtatgtcaat
agcaaggtcagtgtcgagccaacgggagaagcgttcaactccattgttctcgatgagaag
accaatcgtccttataaccccatggtgaatgcaggagcgatcgccactgctgatttaatt
aaaggtaatggtggaaccgaacggcttaaacgcctcctagatatgtttcagcgttatacc
ggacgagagcatgatattaatgtgccagtcttcttgtcggagaaagccacgggtcatcga
aatcgcgcgatcgcctacttaatgcggaattttggcatgattagtgagcaaattgatgaa
acccttgacctttactttcagcaatgttcgatgatggttaatggtcgtgatctagcgatg
atggctgcaaccctagccaatggtggcatgaacccaatcacccaagaacgtgcgattgat
gagcgctatgtccaggatgtgattagtgtgatgctcacctgtgggatgtacgactactct
ggagagtggacttatcgagtggggatgcctgccaaaagcggagttggcggtggtattaca
gccgttgttccggggaaactaggaattggcacattctcaccaccgttagatgtaaaggga
aatagcgtcagaggcatcaaagtttgcgaaaacctctctagagattttggcttacacctg
tttaatgctgccaaacccgaacgagatttggaggcttggattgaaggtagcgattcgatt
gatagttggtag

DBGET integrated database retrieval system