KEGG   Microcoleus sp. PCC 7113: Mic7113_4420Help
Entry
Mic7113_4420      CDS       T02374                                 

Definition
beta-glucosidase-like glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mic  Microcoleus sp. PCC 7113
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mic00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Mic7113_4420
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Mic7113_4420
Enzymes [BR:mic01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Mic7113_4420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5184113..5185228)
Genome map
AA seq 371 aa AA seqDB search
MPAFQELQRFGHHLILGLSGTTLNDDDKRVLSELKPVGVIFFGKNFQMGKPYEVWLQTFK
ELSDQVRQYSERESMFMTLDHEGGTVVRTPLPITRFPHAYLLGELAREVAQATGLELKSL
GINVSWSPVADIFSNPLNPIIGPRAFGITPQTATQGARDYYLGLRESGILGCGKHFPGHG
DTSQDSHLELPILNLTVEELRSRELIPFQSLINEQIPFIMTAHILFPQIDPDVPATLSPT
ILQTLLRKELGFEGVVVSDDLDMKAISERLTQSGTVAQAFQAGCDLLIVSRNLPSSSIER
TYAIAQDFADSLSNGSLDESVIEAAKTRIEKLLNGTPQYSVHALDQDTLVQHAKLAIACS
FQPAVLPETMG
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgccagcatttcaagaacttcagcgctttggacatcacctgattttaggtctttcgggt
actactttaaatgatgacgataagcgtgtactcagcgaattgaaacccgttggagtgatt
ttctttggcaagaactttcaaatgggcaaaccctatgaagtttggttgcaaacctttaag
gaactcagcgatcaagtccgacaatatagcgaacgcgaatccatgtttatgactctcgat
catgaggggggtactgtggttcgcacacctctaccgattacccgatttccacatgcttat
ttgttgggagaactcgctcgtgaggttgcacaggcaacgggattagaattgaagtcactg
ggaattaatgtatcttggtcaccagtcgccgatattttttctaacccccttaaccccatt
attgggcctcgtgcctttgggattactccgcaaactgctacacaaggtgcccgcgactac
taccttggactccgggaatctggaattctaggatgtggtaagcattttcccggacatgga
gacactagccaggactctcacctagagttgccaatcctgaatttaactgtagaagaattg
cgatcgcgtgaacttattcccttccaatcactcatcaacgagcagattcccttcataatg
acggcacacattctgtttccccaaatcgatccagatgtaccagcgacactctcaccgacg
atcttacaaaccttactccgcaaagagcttggttttgagggagttgtggtatctgatgac
ttggatatgaaggctatctcagagcggttgacccaaagtggcaccgtggcacaggcattt
caggcaggttgcgatctgttgattgtatcccgcaacctgccctcctcatcgattgaacgc
acttatgcgatcgcgcaagattttgctgattctctgagcaatggtagccttgatgaatct
gtaatcgaagcggctaagacgcgaatagaaaagctcttaaatggaacgcctcagtattcc
gttcatgctctcgaccaagatacccttgtacaacatgcgaaactcgcgatcgcttgttct
tttcagcctgctgtgttgccagaaacaatggggtaa

DBGET integrated database retrieval system